KEGG   Bordetella pertussis Tohama I: BP2522Help
Entry
BP2522            CDS       T00139                                 

Gene name
folD
Definition
(RefSeq) bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00670  One carbon pool by folate
bpe01100  Metabolic pathways
bpe01120  Microbial metabolism in diverse environments
bpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BP2522 (folD)
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     BP2522 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     BP2522 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH adh_short
Motif
Other DBs
NCBI-GeneID: 2666237
NCBI-ProteinID: NP_881149
UniProt: Q7VVW3
Position
complement(2672195..2673070)
Genome map
AA seq 291 aa AA seqDB search
MHGRRFKKMKAKVIDGSRASARIREQLKERVACLRARNIRPGLAVLLVGEDPASQVYVRN
KVAACEQVGIHSVTERYPSAWTENQLLDRIASLHGDPAINGILVQLPLPPHMSAHRVIEA
ISPLKDVDGFHISNAGLLMTGKPQFQPCTPYGVMKLLESEGVSLRGAEAVIVGASNIVGK
PMAMLLLAAGATVTICNSKTRDLAGQARRADVLIVAAGRAGIVDGSMIKPGAVVIDVGIN
RSPDGRLCGDVDYGSAAKVAGAITPVPGGVGPMTIAMLLANTVEAAERSAI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgcatggacgtagattcaaaaaaatgaaggccaaggtcatcgacggtagccgcgcgtcg
gcgcgtatcagggagcaattgaaggaacgcgtggcctgcctgcgcgccagaaacataaga
ccgggcctggcggtgctcctggtcggcgaagatccggcttcgcaggtatatgtgcgtaat
aaggtggcggcctgcgagcaagtggggattcactccgtcacggagcgctatccctctgcc
tggacggagaatcaactgctcgaccggattgcctcgcttcatggcgatcctgccatcaat
ggcattctggtgcagttgcccttgccgccgcatatgagcgcgcaccgcgtcatcgaagca
atatcgccgctcaaggacgtcgacggtttccatatcagcaacgcaggcctgctcatgaca
gggaagccgcaattccagccctgcaccccttatggggtaatgaaacttctggaatccgaa
ggggtatcgctgcgcggcgccgaagcggtaattgtcggcgccagcaatatcgtcggaaaa
cctatggcgatgttgctgctggcggccggggcgaccgtgacgatatgcaattcgaagaca
cgcgatctggccgggcaggctcgccgggccgacgtgctgattgtcgccgccggccgggcc
gggattgtcgatggatcgatgatcaagcccggcgcagttgtcatcgatgtcggcatcaac
cgtagcccagacggccgcctgtgcggagatgtcgactatggctcggctgccaaggtcgca
ggcgcgatcacgccggtgccgggcggagtgggaccgatgaccattgcaatgctgcttgcc
aataccgtcgaggcggcggaacgatcggctatctga

DBGET integrated database retrieval system