KEGG   Bordetella pertussis Tohama I: BP2910Help
Entry
BP2910            CDS       T00139                                 

Definition
(RefSeq) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BP2910
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BP2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 2666170
NCBI-ProteinID: NP_881492
UniProt: Q7VV03
Position
complement(3101278..3102108)
Genome map
AA seq 276 aa AA seqDB search
MTGDPRTDTTPSCRVAAIQMVSGPDVDENLAQAAELIGKAAQDGARLVALPEYFCFMGHT
DTDKLAIKEESGYGKIQSFLSNISSQYGIWVVGGTLPLTSPDPQRVFNTTFVYGPGGQPA
ARYDKIHLFNFQRGAESYDEAIAIRPGKAVQVFDGPCGRVGLSVCYDLRFPELYRAMGTV
DLILVPAAFTYTTGQAHWELLLRARAIENQCYVLAPAQGGRHSTGRRTWGHSMLVDPWGQ
VLDVLPEGPGVIGGTIEAARLAEVRASLPALRHRVL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgaccctcgaaccgacacaaccccgtcctgccgcgtggcggccatacagatg
gtctccggccctgacgttgatgaaaacctggcgcaagctgctgaattgattgggaaagct
gcgcaggacggcgcgcggctggttgcgttgcccgaatatttctgttttatggggcatacc
gataccgacaaacttgccatcaaggaagagagtggttatggcaaaattcagagctttctt
tcaaatatttcatcccaatatggaatatgggtggtgggcggcaccttgccattaaccagc
ccggacccgcagcgcgtattcaatacaacttttgtatacggacccggcggccagccggcg
gcgcgctacgacaaaatccatttattcaatttccagcgcggcgccgaatcgtacgacgag
gcaattgccatccggcccggcaaagcggtgcaggtattcgatggcccgtgcgggcgggtc
ggactgtcggtgtgctacgacctgcgctttcccgagctgtaccgtgccatgggtacggtc
gacctgatcctggtgccggccgccttcacctacaccacgggccaggctcactgggagctc
ctgctgcgtgcccgcgccatcgaaaaccagtgttatgtgctggcgccggcgcaaggcggg
cggcattcgaccggacggcgcacctggggccattccatgctggtcgacccctgggggcag
gtgctggacgttttacccgaggggccgggcgtcatcggcggtaccatagaggctgcgcgc
ctggctgaggtacgcgccagcctgcctgccctgcgtcatcgcgttctatag

DBGET integrated database retrieval system