KEGG   Bordetella pertussis Tohama I: BP3271Help
Entry
BP3271            CDS       T00139                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN XdhC_C ADH_zinc_N TyrRSs_C
Motif
Other DBs
NCBI-GeneID: 2667483
NCBI-ProteinID: NP_881815
UniProt: Q7VU57
Position
3488548..3489483
Genome map
AA seq 311 aa AA seqDB search
MAERYADWTTLGAQARVQVFRDALPSGPARAVALQPFDVIVAMRERTPFPAELIQALPAL
RLLVTTGMRNNAIDMQACAAGGILVCGAPGSAEAGAATAELAWAHILALFKRLPQEDAAM
RRGLWQTGMPQPLARRRLGVLGLGKLGSAVAQVGRAFGMEVVAWSPNLTDERAAQAGVTR
VDKHTLFSTADVVSLHLILGESTRHIVDAAALSAMKPSAYLVNTSRAGLVDQDALLDALR
KGRLAGAGLDVYESEPLPPTDVWRTLDNVLLTPHLGYVNAENFQAFYANALEAVRAWAAG
APVHVLGGARG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagcgctatgccgactggaccacgctgggcgcgcaggcgcgcgtgcaggtattt
cgcgacgcgctgccttcggggcccgcgcgcgccgtggccttgcagcctttcgatgtcatc
gtggcgatgcgcgagcgcacgccgtttccggccgaactgatccaggcgctgcccgcgctg
cggctgctggtgacgaccggcatgcgcaacaacgccatcgacatgcaggcctgcgccgcg
ggcggcatcctggtgtgcggcgcgcccggcagcgccgaggccggcgccgccacggccgag
ctggcctgggcccacatcctggcgctgttcaagcgcctgccgcaggaagatgccgccatg
cgccgcggcctgtggcagaccggcatgccgcagccgctggcacgcaggcggctgggcgtg
ctgggcctgggcaagctgggcagcgcggtggcgcaggtggggcgcgcgttcggcatggag
gtggtggcctggagtcccaacctcaccgacgagcgcgccgcccaggccggcgtgacgcgg
gtggacaagcacaccctgttttccaccgccgacgtggtcagcctgcatctgatcctcggc
gagagcacccgccacatcgtcgacgcggccgcgctgtcggccatgaagcccagcgcctac
ctggtcaacacctcgcgcgccggcctggtcgaccaggacgcgctgctggacgcgctgcgc
aagggccggctggccggcgccgggctggacgtctacgagagcgagccgctgccccccacc
gatgtctggcgcacgctggacaacgtgctgcttacgccgcacctgggttatgtgaacgcg
gagaacttccaggcgttctatgccaatgcgctcgaggccgtgcgcgcctgggccgcgggc
gcgccggtacacgtgctgggcggcgcccggggctga

DBGET integrated database retrieval system