KEGG   Bordetella pertussis Tohama I: BP3277Help
Entry
BP3277            CDS       T00139                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00071  Fatty acid degradation
bpe00280  Valine, leucine and isoleucine degradation
bpe00281  Geraniol degradation
bpe00310  Lysine degradation
bpe00360  Phenylalanine metabolism
bpe00362  Benzoate degradation
bpe00380  Tryptophan metabolism
bpe00410  beta-Alanine metabolism
bpe00627  Aminobenzoate degradation
bpe00640  Propanoate metabolism
bpe00650  Butanoate metabolism
bpe00903  Limonene and pinene degradation
bpe00930  Caprolactam degradation
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01120  Microbial metabolism in diverse environments
bpe01130  Biosynthesis of antibiotics
bpe01212  Fatty acid metabolism
Module
bpe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BP3277
   00650 Butanoate metabolism
    BP3277
  Lipid metabolism
   00071 Fatty acid degradation
    BP3277
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP3277
   00310 Lysine degradation
    BP3277
   00360 Phenylalanine metabolism
    BP3277
   00380 Tryptophan metabolism
    BP3277
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP3277
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BP3277
   00281 Geraniol degradation
    BP3277
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP3277
   00627 Aminobenzoate degradation
    BP3277
   00930 Caprolactam degradation
    BP3277
Enzymes [BR:bpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BP3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 2666897
NCBI-ProteinID: NP_881821
UniProt: Q7VU52
Position
3494683..3495510
Genome map
AA seq 275 aa AA seqDB search
MSFMRISYISYSDRRQSMSESFVLVETRGRVGWLTLNRPKALNALNDQLMEELGAALLAL
DADDGIGAIVITGSEKAFAAGADIGAMKDWSYMDVYRSDYITRNWETIKRVRKPVIAAVA
GYALGGGCELAMMCDIVIAADSARFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTA
RMMDAAEAERAGLVSRVVPADRLADEALEAATVIASMSLPSVMMAKECINRAYEVPLNDG
LLFERRVFHSLFATEDQKEGMAAFTEKRKPDFKHR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgttcatgcgcatatcttacatttcatactctgacaggaggcaatcaatgagcgag
tcgtttgtgctggtcgaaacccggggccgcgtgggatggctgacgctgaaccggcccaag
gcattgaatgcgctgaacgaccagttgatggaggaactgggcgcggcgttgctggcgctc
gacgccgacgacggcatcggcgcgatcgtgatcaccggcagcgagaaagccttcgccgcg
ggcgcggatatcggcgccatgaaagactggtcctacatggacgtctaccgcagcgactac
atcacccgcaactgggaaaccataaagcgcgtacgcaagcccgtgatcgccgcggtggcc
ggctatgcgctgggcggcggctgcgaactggccatgatgtgcgacatcgtcatcgccgcc
gactcggcccgcttcggccagcccgagatcaagctgggcgtgattcccggcgccggcggc
acgcagcgcctgccgcgcgcggtgggcaaggccaaggccatggacctggcgctgacggcg
cgcatgatggatgccgcggaggccgagcgggccggcctggtatcgcgcgtggtgccggcc
gacaggctggcggatgaggcgctcgaggccgccaccgtcatcgcctcgatgtcgctgccg
tcggtcatgatggccaaggagtgcatcaaccgcgcgtacgaagtgccgctcaacgatggg
ttgctgttcgagcgccgcgtgttccactcgctgttcgccaccgaagaccagaaagagggc
atggcggcgttcaccgagaagcgcaagcctgacttcaagcacaggtag

DBGET integrated database retrieval system