KEGG   Bordetella pertussis Tohama I: BP3403Help
Entry
BP3403            CDS       T00139                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00040  Pentose and glucuronate interconversions
bpe00052  Galactose metabolism
bpe00500  Starch and sucrose metabolism
bpe00520  Amino sugar and nucleotide sugar metabolism
bpe01100  Metabolic pathways
bpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BP3403
   00052 Galactose metabolism
    BP3403
   00500 Starch and sucrose metabolism
    BP3403
   00520 Amino sugar and nucleotide sugar metabolism
    BP3403
Enzymes [BR:bpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BP3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 2667073
NCBI-ProteinID: NP_881931
UniProt: Q7VTV0
Position
3611032..3611940
Genome map
AA seq 302 aa AA seqDB search
MIARGGKKFAASTNFPALPPGVFMQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPL
IQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAH
VNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSV
LGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDH
LRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLI
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagccagaggtggtaaaaagtttgccgcttcgacaaattttcccgcacttccccct
ggagttttcatgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgt
tttctgcccgccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctg
atccaatatgccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacg
ggccgcaacaagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgac
ctggaagcgaagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcac
gtgaactgcctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacg
gccgcgccggcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgac
gccgacacgccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtg
ctgggcgtacaggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccag
ccagtcgatgcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaa
gcccccaccaccctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccat
ctgcgtgccaccacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcg
ctgctgcgcgaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggc
agcaaggcgggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgatt
ccggaataa

DBGET integrated database retrieval system