KEGG   Bordetella pertussis Tohama I: BP3494
Entry
BP3494            CDS       T00139                                 

Symbol
brkA
Name
(GenBank) serum resistance protein
  KO
K12683  serum resistance protein
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP3494 (brkA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP3494 (brkA)
   02044 Secretion system [BR:bpe02044]
    BP3494 (brkA)
Transporters [BR:bpe02000]
 Other transporters
  Pores ion channels [TC:1]
   BP3494 (brkA)
Secretion system [BR:bpe02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   BP3494 (brkA)
SSDB
Motif
Pfam: Pertactin Autotransporter AC_1
Other DBs
NCBI-ProteinID: CAE43755
UniProt: Q45340
Structure
PDB: 
3QQ2

Position
3703057..3706089
AA seq 1010 aa
MYLDRFRQCPSSLQIPRSAWRLHALAAALALAGMARLAPAAAQAPQPPVAGAPHAQDAGQ
EGEFDHRDNTLIAVFDDGVGINLDDDPDELGETAPPTLKDIHISVEHKNPMSKPAIGVRV
SGAGRALTLAGSTIDATEGGIPAVVRRGGTLELDGVTVAGGEGMEPMTVSDAGSRLSVRG
GVLGGEAPGVGLVRAAQGGQASIIDATLQSILGPALIADGGSISVAGGSIDMDMGPGFPP
PPPPLPGAPLAAHPPLDRVAAVHAGQDGKVTLREVALRAHGPQATGVYAYMPGSEITLQG
GTVSVQGDDGAGVVAGAGLLDALPPGGTVRLDGTTVSTDGANTDAVLVRGDAARAEVVNT
VLRTAKSLAAGVSAQHGGRVTLRQTRIETAGAGAEGISVLGFEPQSGSGPASVDMQGGSI
TTTGNRAAGIALTHGSARLEGVAVRAEGSGSSAAQLANGTLVVSAGSLASAQSGAISVTD
TPLKLMPGALASSTVSVRLTDGATAQGGNGVFLQQHSTIPVAVALESGALARGDIVADGN
KPLDAGISLSVASGAAWHGATQVLQSATLGKGGTWVVNADSRVQDMSMRGGRVEFQAPAP
EASYKTLTLQTLDGNGVFVLNTNVAAGQNDQLRVTGRADGQHRVLVRNAGGEADSRGARL
GLVHTQGQGNATFRLANVGKAVDLGTWRYSLAEDPKTHVWSLQRAGQALSGAANAAVNAA
DLSSIALAESNALDKRLGELRLRADAGGPWARTFSERQQISNRHARAYDQTVSGLEIGLD
RGWSASGGRWYAGGLLGYTYADRTYPGDGGGKVKGLHVGGYAAYVGDGGYYLDTVLRLGR
YDQQYNIAGTDGGRVTADYRTSGAAWSLEGGRRFELPNDWFAEPQAEVMLWRTSGKRYRA
SNGLRVKVDANTATLGRLGLRFGRRIALAGGNIVQPYARLGWTQEFKSTGDVRTNGIGHA
GAGRHGRVELGAGVDAALGKGHNLYASYEYAAGDRINIPWSFHAGYRYSF
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgtatctcgatagattccgtcaatgtccgtcttccttgcagatcccgcgttccgcgtgg
cgcctgcatgcgctggccgcagctctggcgctggccggcatggcccggctggcgcccgcg
gcggcgcaggcgccgcagccgcccgtggccggcgcgccgcatgcgcaggacgccgggcag
gaaggagagttcgaccaccgggacaacacgctcattgcagtctttgacgacggcgtcggc
atcaatctcgacgacgatcccgacgagctcggcgagacggcgccccccacgctcaaggac
atccacatctcggtggagcacaagaacccgatgagcaagccggccatcggggtgcgtgtc
agcggcgccggccgcgcgctgacgctggccggctcgaccatcgatgccaccgagggcggc
attcccgcagtggtacggcgcggcggcacgctggagctggatggcgtcaccgtggcgggc
ggggaagggatggagccgatgacggtctctgacgccggcagccgcctgagcgtgcgcggc
ggcgtgctgggcggcgaagcgccgggcgtcggcctggtccgggccgcgcaaggcggccag
gcgagcatcatcgacgcgacgctgcagagcatcctcgggcccgcgctcattgccgacggc
ggctccatttccgtcgccggcggttcgatcgacatggacatgggcccgggattcccgccg
ccgcctccaccgcttcccggggcgccgctggccgcgcatccgccgctcgatcgcgttgcc
gcggtgcacgccggccaggacggcaaggtgacactgcgggaggtggcgctgcgggctcac
gggccgcaggcgacgggcgtctatgcgtatatgcctggcagcgaaatcaccctgcaggga
ggcacagtcagcgtgcagggcgatgacggggccggcgtggtcgccggcgcgggcctgctc
gacgccttgccgcccggcggcacggtgcggctggacggaaccacggtgtcgaccgatggc
gccaacaccgatgccgtgctggttcgcggcgacgcggcgcgcgccgaggtcgtcaacacc
gtgctgcgcaccgccaagagcctggccgccggcgtatcggcccagcatggaggccgcgtc
acgctgcggcagacccgcatcgagaccgcgggcgcgggggccgagggcatctccgtgctg
ggcttcgagccgcagtccggctccggcccggccagcgtcgacatgcagggcggcagcatc
accacgaccggcaaccgcgccgccggcatcgcgctcacccacggcagcgcccgcctggaa
ggcgtggcggtgcgcgccgagggcagcggctcgagcgccgcgcagctggccaacggcacg
ctggtcgtcagcgcagggtcgctggcctcggcccagtccggcgcgatcagcgtgaccgac
acgccgctgaagctgatgccgggcgccctggccagcagcacggtctcggtccggttgacc
gacggcgccacggcgcaaggcggcaatggcgtgttcctccagcagcattccaccattccg
gtggcggttgccctcgagagcggcgccctggctcgcggcgatatcgtcgccgacggcaac
aagcccctcgatgccgggatctccctcagcgtggccagcggcgccgcctggcacggcgcc
acccaggtgctccagtcggccacgctgggcaagggcggaacctgggtcgtgaacgccgac
tcccgggtgcaggacatgtcgatgcgcggcgggcgggtcgaattccaggcgcccgcgccc
gaggcctcttacaagaccctgaccctgcaaaccctggacggcaacggcgtgttcgtgctg
aacaccaacgtcgccgccgggcagaacgaccagttgcgggtcaccggccgcgccgatggc
cagcaccgcgtgctggtgcgcaatgccggaggcgaggccgacagccggggcgcccgcctg
ggcctggtgcatacccaggggcagggcaacgccaccttccggctggccaacgtcggcaag
gcggttgacctgggcacgtggcgctacagcctggcggaggatccgaagacgcatgtctgg
agcttgcagcgcgcgggccaggccctgtcgggggcggccaatgccgccgtgaacgcggcg
gatctttccagcatcgccctggccgagtccaacgcgctggacaagcgcctgggcgagctg
cgcctgcgcgccgacgccggcgggccatgggcgcgtacgttcagcgagcgccagcagatc
agcaaccgccacgcccgcgcctacgaccagacggtcagcgggctggagatcggcctggac
cgtggctggagcgcgtcgggcgggcgctggtacgccggcggcctgctcggctacacctat
gccgaccgcacctatcccggcgacggtggcggcaaggtcaagggcctgcacgtcggcggc
tacgccgcctatgtcggcgatggcggctactatctcgacaccgtgctgcggctgggccgc
tacgatcagcaatacaacattgccggcaccgatggcggccgcgtcaccgccgactaccgc
acaagcggcgccgcatggtcgctcgaaggcgggcgccggttcgagctgcccaacgactgg
ttcgccgaaccgcaggccgaggtcatgctgtggcgcacgtcaggcaagcgctatcgcgcc
agcaatggcctgcgcgtcaaggtggacgccaacaccgccacgctgggccgcctgggcttg
cgcttcggccgccgcatcgccctggccggcggcaacatcgtgcagccctacgccaggctc
ggctggacgcaggagttcaaaagcacgggcgatgtgcgcaccaatggcattggccatgcc
ggcgcaggccgccacggccgcgtggaactgggcgcgggcgtcgacgccgcgttgggcaag
gggcacaacctctatgcttcgtacgagtacgcggcgggcgaccggatcaacattccgtgg
tcgttccacgccggctaccgctacagcttctga

DBGET integrated database retrieval system