KEGG   Bordetella pertussis Tohama I: BP3543Help
Entry
BP3543            CDS       T00139                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 2665162
NCBI-ProteinID: NP_882058
UniProt: Q7VTJ3
Position
complement(3755134..3756087)
Genome map
AA seq 317 aa AA seqDB search
MTTKHRIIQVGSLAGSPTANRRLADEYDVLELWQQADRAAALARHGKGVTALVTSANFGA
DAALIDALPDLKAICSWGVGYETIDVDAARKRGVLVSNTPDVLTDCVADLAWGLLISGAR
RMAQGDRFVRAGQWGQVHGSIPLGTRVSGKNLGIIGLGRIGEAIARRGDGFDMQVRYHNR
RRRDDVSYGYESSLADLARWADFLVVATVGGPSTRHLVNQEVLEALGPKGLIINIARGPV
IDEAALVAALQAGKLGGAALDVFEHEPLVPDALKASDDTVLLPHISSATFETRMAMENLM
LDNLASFFKTGDVITPV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaagcaccgcatcatccaggtaggctccctggccggatcgccgacggccaat
cggcgactcgccgacgaatacgatgtgctcgaactgtggcagcaggccgaccgtgcggcc
gcgctggcccggcatggcaagggcgtcaccgcgctggtcacctcggccaatttcggcgcg
gatgccgcgctgatcgacgcgctgcccgatctcaaggcgatctgcagctggggcgtgggt
tacgaaaccatcgacgtcgatgccgcccgcaagcgtggcgtgctggtcagcaacaccccc
gatgtgctcaccgattgcgtggccgacctggcctggggcctgctgatttcgggcgcccgc
cgcatggcgcagggcgaccgcttcgtgcgcgccggccaatggggccaggtgcatggcagc
attccgctgggcacgcgggtcagcggcaagaacctcggcatcatcggcctgggccgcatc
ggcgaagccatcgcccggcgcggcgacggcttcgacatgcaggtgcgctaccacaaccgc
cgccggcgcgacgacgtcagctatggctacgaaagctcgctggccgacctggcgcgctgg
gccgatttcctggtggtcgccacggtgggcggcccgagcacccgccacctggtcaaccag
gaagtgctggaagcgctgggccccaagggcctcatcatcaacatcgcccgcggcccggtc
atcgacgaagccgcgctggtggccgcgctgcaggccggcaaactgggcggcgcggcgctg
gacgtgttcgaacacgaacccttggtgcccgacgcgctgaaagccagcgacgacaccgtg
ctgctgccgcacatcagcagcgccaccttcgagacccgcatggcgatggaaaacctgatg
ctggacaacctggcctcgttcttcaagaccggcgacgtcatcacccccgtatag

DBGET integrated database retrieval system