KEGG   Bordetella pertussis Tohama I: BP3792Help
Entry
BP3792            CDS       T00139                                 

Gene name
ptlI
Definition
(RefSeq) type IV secretion system protein PtlI
  KO
K03202  type IV secretion system protein VirB7
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP3792 (ptlI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpe02044]
    BP3792 (ptlI)
Secretion system [BR:bpe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BP3792 (ptlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2665413
NCBI-ProteinID: NP_882291
UniProt: Q7VSX7
Position
3995943..3996128
Genome map
AA seq 61 aa AA seqDB search
MIHAHSNARLLRWAILAIAPVTLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRA
P
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgcacattccaacgccagattattgcgatgggccatcctggccatcgccccc
gtcacgctcggcgcctgcgccccgaacgggccgcccggcttgccgtatcccgatggcaag
cccctgattcccatcaacaccgccgccccggagcaaggatcgtcatgccagacccgcgcc
ccttga

DBGET integrated database retrieval system