KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154226Help
Entry
110154226         CDS       T05002                                 

Gene name
dcxr
Definition
(RefSeq) L-xylulose reductase isoform X1
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00040  Pentose and glucuronate interconversions
bpec01100  Metabolic pathways
Module
bpec_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110154226 (dcxr)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110154226 (dcxr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase 2-Hacid_dh_C RmlD_sub_bind ApbA DUF1776
Motif
Other DBs
NCBI-GeneID: 110154226
NCBI-ProteinID: XP_020773854
Position
Unknown
AA seq 257 aa AA seqDB search
MGTTLCWSWILGQMEISFAGKHALVTGAGKGIGRATACSLSRCGAKVTALTRTQTDLDSL
LLECPSIVPVCVDLSDWGATAAALEHAGPFDLLVNNAACAILQPFLEVTPEKFDQLFSVN
VKAVLHVSQIVARSMKARGSGGSIVNVSSQASQCALRDHTVYCSTKAALDMLTKVMALEL
GPYKIRVNCVNPTVVMTEMGRIGWSDAEKASAMKSRIPLGQFAEVEDVVNSILFLLSDKS
NMTSGATLPVDGGFLCC
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgaccctgtgctggtcttggattcttggacagatggagatctcgttcgcgggg
aagcacgctctagttacgggagcagggaaagggattggcagagccacagcatgttctctg
tcccgctgtggggcaaaggtgaccgctctcacacgcacacagactgacctggacagcctg
cttctcgagtgcccctccattgttcctgtgtgtgtggacctgtctgactggggggctaca
gcagctgctctggagcatgcaggaccctttgatctgcttgtcaacaatgcagcctgtgcc
attctgcaaccattcctagaggtcaccccagagaagtttgaccagttattcagtgtgaat
gtgaaggcagttctacatgtgtctcagatagtggcccgctccatgaaagcacggggctct
ggagggtccattgtgaatgtgtccagtcaagcttcacagtgcgctctcagggatcacact
gtctactgttcaactaaagcagccttggacatgctcaccaaagttatggctctggagctg
ggtccttataagatccgtgtgaactgtgtgaaccccacagtggtgatgactgagatggga
cgtatcggttggagtgatgctgaaaaagcaagtgctatgaagtctcgcatccccctgggt
caattcgcagaagtggaagatgtggtcaatagtattttgttcttgctgagtgacaagagc
aacatgaccagtggagcaacgctgccagtggatgggggcttcttgtgttgttaa

DBGET integrated database retrieval system