KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154498Help
Entry
110154498         CDS       T05002                                 

Gene name
fkbp1b
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1B isoform X1
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bpec03110]
    110154498 (fkbp1b)
Enzymes [BR:bpec01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110154498 (fkbp1b)
Chaperones and folding catalysts [BR:bpec03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    110154498 (fkbp1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 110154498
NCBI-ProteinID: XP_020774149
Position
Unknown
AA seq 108 aa AA seqDB search
MGVEVETISPGDGRTFPKKGQTCVVHYIGMLQNGKKFDSSRDRNKPFQFRLGKAEVIKGW
EEGVAQMSLGQRAKLTCTPDMAYGVVGHPGVIPPNATLIFDVELLKLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggaagtcgaaactatatctccgggtgacgggagaacatttccaaagaagggc
cagacatgcgtggtacattacataggtatgctgcaaaatggaaaaaagtttgactcttct
cgagataggaacaaaccttttcaattcaggcttggaaaggcggaggtcattaagggctgg
gaagaaggagtagcacagatgagcctgggccagagagctaaactcacgtgcacaccagac
atggcctatggagttgtaggtcaccccggggtcatcccgccgaacgccacgcttatattt
gacgtagaattacttaaactggagtaa

DBGET integrated database retrieval system