KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154571Help
Entry
110154571         CDS       T05002                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00450  Selenocompound metabolism
bpec00970  Aminoacyl-tRNA biosynthesis
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110154571 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110154571 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpec01007]
    110154571 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpec03016]
    110154571 (mars)
Enzymes [BR:bpec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110154571 (mars)
Amino acid related enzymes [BR:bpec01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110154571 (mars)
Transfer RNA biogenesis [BR:bpec03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110154571 (mars)
 Prokaryotic type
   Other AARSs
    110154571 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C Anticodon_1 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 110154571
NCBI-ProteinID: XP_020774228
Position
Unknown
AA seq 913 aa AA seqDB search
MKLFLSEGNPQCLKALAALEVTRAKCDVQYVNHEDKVVPFLSRPVLPALLLPSGQHLFSP
NAICRYMFEVSGQDSGALCDQWLEWEATNLQPALVQALHLAVLQGKGSEVPKIIQGSLNY
LDQNLSKGKTTYLTGESISAADIVLWAALFPLFSDSTVPTGEHKTVTLWFNHVNGLNACQ
SSAQKVLQGKGLQGMKSYMQKQPAPPSSHSRDVQPSTSSPAEGDDGERLVSEEEMEAAAL
SYSKGLSIFKDTERKHPILPQEGKRNILLTSALPYVNNVPHLGNIIGCVLSADVFSRYGR
LRGWNLLYVCGTDEYGTATENKAREEGLTPQQICDKYHAVHASIYKWFQIDFDFFGRTTT
SKQTEIAQDIFWHLHKHDFLVEDTVEQLRCENCQRFLADRFVEGICPFCNYPEARGDQCD
KCGRLINAVELKQPQCKVCKQTPVIQTSKHLFLNLPKLETQLEQWLDKSTSTGDWTANAK
QITRSWLRDGLKPRCITRDLQWGTPVPHPDFKEKVFYVWFDAPIGYLSITANYTDQWEKW
WKNPQQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVSHLVATEYLNYEDTKFSKSRG
VGVFGDMAKDTGIPSDVWRFYLLYVRPEGQDSAFSWADMAMKNNSELLNNLGNFINRAGM
FVTKFFEGCVPVMDLQPEDKRVLALVGWELQQYIQLMDKVKLRDALKHILNISRHGNQYI
QVNEPWKKIKGGDSERQRAGTVTGVSVNISCLLSVMLLPYMPTVSQTIRDQLNAPPSCIS
SMLQGSGTFVCALNAGHRIGTVSPLFQKLEAEHIETLKKKFGGQQEDEPPKIQPKSTASS
AASPQPAVVPAPATEAIVAGGVDPEKAKLLTQAVAEQGEKVRALKTQKADKAVITAEVAK
LLDLKKHCIQSDI
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatttttgagtgaaggcaaccctcagtgcttaaaggcgttagccgcgttagaa
gtgacacgggctaagtgtgacgtgcagtatgtcaaccacgaggataaagtggtgcccttc
cttagccgtcctgtgctgccagcactgttgttacccagtggacagcatctgttcagcccc
aatgccatttgccgatacatgtttgaagtaagcggacaggactctggtgcattatgcgat
caatggcttgagtgggaggccacaaatctgcagcctgcacttgtacaggcccttcatctg
gcagtgctacagggaaaagggtctgaggtgccgaagatcatccaagggtccttaaactat
ttggaccagaacttgagtaaaggaaagacaacatatttgactggagagtctatatcggct
gcggacattgtcttgtgggctgcattgtttcctcttttctctgattcaacagtgccaaca
ggtgagcacaagactgtgacactatggttcaaccatgtgaacggtttgaatgcgtgccag
tcgtcagcgcagaaagtcctccagggaaaaggcctgcagggcatgaagagctacatgcag
aagcagccagcccctccgagcagtcacagtagagacgtgcagccaagcaccagcagccct
gctgagggagacgatggggagcgcttagtttcagaagaagagatggaggctgctgctctc
agctacagcaaaggtttaagcatctttaaggatactgaaagaaaacacccaatattgcct
caggagggcaaaagaaacatccttttgaccagtgccttgccttatgttaacaatgtcccc
catttgggtaacatcattggttgtgtcctcagtgcagatgtattttccagatacggccgt
ttgcgaggctggaacctgctgtatgtgtgtggtactgatgagtatgggacagctacagaa
aacaaagcgagagaggagggcctcactccccagcagatctgtgacaagtaccacgctgtt
cacgccagcatctacaagtggtttcagatagactttgacttttttggaagaaccaccacg
tcaaagcaaacagaaatagcccaggacatattctggcaccttcacaaacatgatttcttg
gtggaggacacggtggagcagctcagatgtgaaaactgtcagcgcttcttggcagatcgt
tttgttgaaggcatctgtcctttctgtaattacccagaagcccgtggtgaccagtgcgat
aagtgtggccgactaatcaatgctgtggagctcaagcaaccacagtgtaaggtctgcaag
cagactccagtcatccaaacctccaaacatcttttcctcaacctgccaaagttggagaca
cagttggaacagtggctagataagtcaaccagtacaggagactggacagcaaatgcgaag
caaatcacccgctcctggttacgagatggactcaaacctcgctgcatcaccagggactta
cagtgggggacaccagtgccacaccctgactttaaagaaaaggtgttttatgtgtggttt
gatgcacctattgggtatctgtcgattactgccaattacaccgaccaatgggagaagtgg
tggaaaaatcctcaacaggtggagttgtacaacttcatggccaaagacaacgttcccttc
catagcgttgtctttccctgctccctactgggagcccaggacaactacactctggtcagt
caccttgtggccacagagtatttgaactatgaggacaccaagttctccaaaagccgtggt
gttggtgtatttggggacatggccaaagacacagggattccatctgacgtgtggcgcttc
tacctactctatgtgcgtccggaggggcaggactcagccttctcctgggcagatatggct
atgaagaacaactctgagctgctcaacaacctgggcaactttatcaatagagctggtatg
tttgtcacaaagttctttgagggctgtgttcctgtgatggaccttcagccagaggataag
agagtcctcgctctggtgggctgggagctgcaacagtacattcagctcatggacaaagtc
aaactacgtgatgctctcaagcacatattgaatatctctcggcatggcaaccagtacata
caagtaaatgaaccttggaaaaagattaagggaggagacagtgaaaggcaacgtgctggc
acagttactggtgtgtctgtcaacatctcctgcttgctgtcagtgatgcttttgccatac
atgccaactgtcagccaaaccatccgggatcagctcaacgcccctccatcctgcatcagt
tccatgttgcaaggctctggcacctttgtgtgtgccctgaacgcaggccaccgcattggc
acagtcagtccgttgttccagaaactggaggccgaacatattgagactttaaagaagaaa
tttggtggacagcaggaagatgaaccaccaaagatacagcccaaatccacagcttcaagt
gctgccagccctcagcctgctgtggttcccgctccagccactgaggcaattgtggcgggc
ggagtggaccccgagaaagccaagctgctcacacaggcagtggctgagcagggggagaag
gtgcgagcgttaaaaactcaaaaagcggataaggctgtgatcactgcagaggtggccaaa
ttgttggatctgaagaaacattgcattcaatcggacatatga

DBGET integrated database retrieval system