KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155185Help
Entry
110155185         CDS       T05002                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00071  Fatty acid degradation
bpec01212  Fatty acid metabolism
bpec03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110155185
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110155185
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110155185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf TFIID_NTD2
Motif
Other DBs
NCBI-GeneID: 110155185
NCBI-ProteinID: XP_020774902
Position
Unknown
AA seq 386 aa AA seqDB search
MEGLAADCLELIELDPPAPPSPAFDEYLCERNSVVINSNPFACFSPDPKPEYNDQLIRAT
NIVCSIVRYVKTLRAGVLEPEVFHMNPAKSDTDQFKKFIRWVPSSLSCYAAYLVNAYPLD
MSQYLQLFNSTRLPKQGRDELFMDEKGRHLLVMXKGNLYTFDIVDRGGNLVNPAEIHSHL
KYILSDETPAASSAIGVLTSENRDVWAGLREKLIASGNGGLLQTVDSALFCLCLDDQVMK
DNIHMCHTMLHGDGCNCWFDKSFNIIITKDGNAGISFEHSGRDGETIVTLMTKIFKDTME
KPIVNPGSAPAAVDSASTVQRLQFNLDGKLKSDIQKAKENFDAAVSKLTLSDLMFKKGGK
EQLKKNKLSSDSIAQLAFQMGFLRQV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagggacttgcagcagactgcctcgagctgattgagctcgatccacctgcgccgcca
tcacctgcttttgacgaatacctctgtgaacggaactctgtcgtcatcaactctaacccc
ttcgcctgcttcagtcccgaccccaaaccagaatacaacgaccagctcatccgtgccacc
aacattgtgtgttccatcgttcgttatgtgaaaacactgagagcaggagtactagaacct
gaagtcttccacatgaaccctgctaaaagtgacacagaccaattcaaaaagttcatccgt
tgggttccctcctcgctgtcctgctatgcagcctacctggtcaacgcatatcctttggac
atgtcccagtatttacagcttttcaattctaccagattgccaaaacaaggaagagacgag
ctgtttatggatgagaagggaaggcatcttttagtgatgtgaaaaggcaatttgtacacg
tttgatattgtcgatcgcggtggaaatttggtgaatccggcagagattcactctcatttg
aagtacattttgtcagatgaaaccccagcagcttccagtgcgattggtgtcttaacaagt
gagaatagagacgtgtgggcaggtttaagggagaagctaatcgccagtggcaacggagga
cttttacagaccgtggacagtgcattgttttgcctctgtcttgatgaccaagttatgaag
gacaatattcacatgtgtcacaccatgcttcatggagatgggtgtaattgctggtttgac
aagtccttcaatatcatcataaccaaagacggaaatgcagggatcagttttgagcattca
ggaagagatggagagacaatagtcacactcatgactaaaatcttcaaagatacaatggaa
aaacccattgtgaaccctggctctgctcctgccgctgtagactcggcctccactgtccaa
agactgcagttcaacttagatggtaaattgaaaagcgatattcaaaaagccaaggagaat
tttgatgcagcagtatcgaaattgaccctaagtgatttgatgtttaaaaagggaggtaaa
gagcagttgaaaaagaacaagttgagttcagattctatcgctcaattggcattccaaatg
gggtttttgaggcaggtctaa

DBGET integrated database retrieval system