KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155354Help
Entry
110155354         CDS       T05002                                 

Definition
(RefSeq) type-1B angiotensin II receptor-like
  KO
K04296  leukotriene B4 receptor 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110155354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bpec04030]
    110155354
G protein-coupled receptors [BR:bpec04030]
 Rhodopsin family
  Lipid
   Leukotriene
    110155354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 110155354
NCBI-ProteinID: XP_020775115
Position
Unknown
AA seq 273 aa AA seqDB search
MDHLNLTSANLTNSSTVGPPFSISGLRALVPVGLMSLCFLVGIPGNIAVLILRPNWQKLS
KLTQCLMMNLAMSDLLCLATLPMWIYAVLYDWTLGVATCKIVGFIVHCSIYSSVLTITAL
SVQRYIQVVHPQRCLQFKKRLLALMWIMSMVLSVQIITDELQKISCFTKYSSTQNVAMLL
TECVVGFSSFTITACAYFFLHRKLNQAIIVTFFVLWMPYLIFNLVIVGGCFSKNLKIVQF
YENGFNFFAGAVLGMDRQGSCPGRNFVGGGMSA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaccacctgaacctaacctctgctaatctcaccaactcctcaactgtaggacctcca
ttttcaatttctggtttaagagctctggtcccagtaggactaatgtccctatgcttcctt
gtgggaatccctgggaatatagcagttttaatcctcagaccaaactggcagaagctgtcc
aaactgacccagtgtctgatgatgaacctggccatgtctgacctactgtgcctggccacc
ctgcctatgtggatctacgctgtactttatgactggaccctaggcgtcgccacctgtaag
attgttggttttatagttcattgtagtatctacagcagtgtgctgactataactgctctg
agtgtccagcgctacattcaggttgtgcatccacagagatgtctccagttcaagaagaga
cttcttgccctaatgtggatcatgtcgatggtcctgtctgttcaaatcatcactgatgaa
ctgcagaagatcagctgtttcacaaaatacagctctacacaaaatgtggctatgttactc
actgaatgcgttgttggattcagttcattcaccattactgcatgtgcatatttttttctg
cacagaaagctaaaccaggctatcatagtgacattttttgtattgtggatgccatactta
atttttaatcttgtgattgtgggagggtgttttagcaaaaacctgaagattgttcagttt
tatgaaaatggctttaacttttttgcaggggcggtcctaggcatggaccgacagggcagc
tgtccggggcggaacttcgtggggggcggtatgagtgcttga

DBGET integrated database retrieval system