KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110155883Help
Entry
110155883         CDS       T05002                                 

Gene name
dpp3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpec01002]
    110155883 (dpp3)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     110155883 (dpp3)
Peptidases [BR:bpec01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   110155883 (dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 110155883
NCBI-ProteinID: XP_020775715
Position
Unknown
AA seq 726 aa AA seqDB search
MVDSQYYLPNDIGISALDCGEAFRLLSPQEKKYAHYLSQAAWYGGLVVLLQTSPESPNIF
VLLQKVFRKQTPAQLEKLATSVGLSSEEYQAFLVYAAGLYANMGNYKSFGDTKFIPNLPK
DKFKALIWASLAFQEQPAEMKTLWDSCACLLYSLNDKQKQLGLGDKGITTYFSGNCGLAD
AEIAQKFLDSKKLSAYNTRLFKKEEGGKTCYEVRLASAVKQDCAVNGECESCCGTFCFGD
KDFTVTRGDYAPLMEKVAFYLQQAQSYAANENQKKMIENYRRSFTLGSVDAHKEGSRYWI
KDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFARLVSSAEVLLPELPWPK
EFEKDTFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLSVAYATKK
EKLTFLKEDDKDLFIKWKGPSFEVQVGLHELLGHGSGKLFVQDDEGKFNFDQSKLINPET
GELVSSWYRGSETWDSKFSTIASSYEECRAECVGLYLCLNPQVLSIFGHEGQDAQDVVYI
NWLSMVRAGLLGLEFYTPESKSWRQAHMQARFVILSVLLEAGEGFVGLQEVTGQDGKPDA
VITLDRCKIHTVGKDAINRFLQKLQVFKSTADVEGGRALYEKYSTVSDSGPHNFLRLRET
VLLRKEARKMFVQANTKVRGEEVELVEYEGSAAGLITSFVERFQEDTEQLEEQLLELSKR
DAPCWC
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtagattctcagtactacctcccaaatgacattggtatctcagcactggactgtggt
gaggcctttcgcttgctctcccctcaagaaaagaaatacgcccattacctttctcaagct
gcctggtatggtggccttgtggtgctgttgcagacatctccagagtctccaaacattttt
gtgttgctgcagaaagttttcagaaagcaaacgcctgcacagttggaaaagcttgccact
tcagtcggtcttagctctgaagaataccaggcctttttggtgtatgcagctggtctatat
gccaatatgggaaactacaagtcctttggagacaccaaattcataccaaatctacccaag
gacaagttcaaggccttgatttgggcgagcctggcttttcaggagcagcccgctgagatg
aagactctctgggacagctgtgcctgtctgctttactctctaaatgacaaacagaaacag
ctcgggctcggagacaagggcattacaacctacttctctgggaactgtggtctggcggat
gcagagattgcccagaagtttcttgactcaaaaaaactatctgcatacaacacccgtttg
tttaagaaagaagaaggaggaaaaacctgctatgaagtgcgtctggcctctgctgtgaag
caagactgtgcagtaaatggagaatgtgagtcttgttgtggcactttctgtttcggagac
aaagacttcactgtgaccagaggggactatgctcctctgatggaaaaggtcgctttctac
ctccaacaagctcagtcatatgctgccaatgaaaaccaaaagaagatgattgaaaattac
aggcgtagcttcacattgggctcagtcgatgcccataaagaaggctctcgctactggatc
aaagacaaggggccaattgtagagagttacattggtttcattgaaagctacagggatccc
tttgggtcaagaggggaatttgaaggttttgtagcggtggtaaacaaagccatgagtgag
cgttttgcgaggctggtgagctccgctgaggtgctcctgccggaactgccgtggcccaaa
gagtttgagaaggacacatttctcaaaccagatttcacttcactagatgtcctcaccttt
gctgggagtgggatcccagccggtatcaacatccccaactatgatgatatccgacagtca
gagggctttaagaacgtgtctttaggaaatgtgctctctgtagcctatgccacaaagaaa
gaaaaactcactttcctgaaagaagatgacaaggatttatttattaaatggaaaggccct
tcatttgaggtgcaagttggtcttcacgagctgctgggacatggcagtgggaagctattt
gtccaggacgatgagggcaaattcaactttgatcagagcaaattaatcaatccagaaact
ggtgaattggtgtccagctggtaccggggcagtgagacgtgggacagtaaattcagtacc
atcgcctcttcctatgaggagtgccgcgccgaatgtgttggcctatatttgtgtcttaat
ccacaagtgctcagcattttcggccatgagggtcaggatgcgcaagatgtggtctacata
aactggctgagtatggtccgagctggtctgctgggtctggagttttacacgcctgagagc
aagagctggagacaggcccacatgcaggctcggtttgtgatcctgagtgttttactggag
gctggagaggggtttgttggtctgcaagaagtgaccggacaagacggaaaaccagacgct
gtgatcacactggaccgctgcaagatccacactgtgggcaaggatgccatcaacaggttt
cttcaaaaactgcaggtgtttaagtcaacagctgatgttgagggaggaagggctctctat
gagaaatactccaccgtcagcgatagcggacctcacaacttcctgcgtctcagagaaacg
gtcctactacgaaaagaggctcgcaaaatgttcgtccaggccaataccaaagtcagagga
gaggaggtggagctggtggagtacgagggcagtgcagccggtctcatcacctcgtttgtg
gagcgttttcaggaggacactgagcagctggaggaacagcttctggagctcagcaaaaga
gatgccccctgctggtgctga

DBGET integrated database retrieval system