KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110156474Help
Entry
110156474         CDS       T05002                                 

Gene name
mrpl22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    110156474 (mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpec03011]
    110156474 (mrpl22)
Ribosome [BR:bpec03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    110156474 (mrpl22)
  Bacteria
    110156474 (mrpl22)
  Archaea
    110156474 (mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 110156474
NCBI-ProteinID: XP_020776336
Position
Unknown
AA seq 207 aa AA seqDB search
MATSLTGRGLAFIRTLPNLVHSRLPWLAAPQQLSCFHTSVSLEGRKWDQKNLKVYPPQLP
DEPRRPAEIYHSKRQFKYSKDKLWYLANLVKGLSIDEAIAQLEFNDKKGAKFMKEVLLEA
QEMAVKNHNVEYKSNLYIAESMSGKGKYLKRIRYHGKGMFGIMDKVYCHYFVKLVEGPPP
KKTQKTSLEAAKEYVQGLKSRTVIHSL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcgttgacaggacgaggtctagccttcatcaggacgttaccgaacctggta
cattcacggttgccatggttggcggctccccagcagttgtcctgttttcacaccagtgtc
tctttagagggacggaaatgggatcaaaaaaatctgaaagtttatcctcctcagttgcca
gatgaaccacgcagaccagccgaaatctatcatagcaagaggcagttcaaatacagcaaa
gacaaattgtggtatttggccaatctggtcaaaggattgagcattgatgaagcaattgcc
caactcgaattcaatgacaagaaaggagccaagttcatgaaagaggttctccttgaagct
caggagatggctgttaaaaaccacaatgtagagtacaagtccaacctgtatatagccgag
tccatgtctggaaaaggtaaatacctgaagaggatccgatatcacggcaaaggcatgttc
ggcattatggacaaagtttactgtcattattttgtcaaactcgtcgagggtcctccgccc
aaaaagacacaaaagaccagtttagaagcagcaaaagaatatgtccagggactcaagagc
cgtacggtcatccacagtttataa

DBGET integrated database retrieval system