KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157067Help
Entry
110157067         CDS       T05002                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00010  Glycolysis / Gluconeogenesis
bpec00562  Inositol phosphate metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110157067
   00562 Inositol phosphate metabolism
    110157067
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110157067
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110157067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 110157067
NCBI-ProteinID: XP_020776979
Position
Unknown
AA seq 473 aa AA seqDB search
MGRAKYICCITCNAMMSSDCKFVFLTTLVILYSCFFGVNSLDVFSIPTIAKYFSTKGRYE
EVNPHLIEDILAVNTSIIRPPSPQCREIHLTAIIRHGTRYPTSKNVLKMLEFYDIVRKSA
ATSGDEGWLREIREEWTMWYTEDMDGRLVQKGMEDHRHLAVRLSKLFPRLISEEKLRGGL
IKFITSSKHRCVNSTLSFKRGLTELWGIKDMEFDHTVNDALMRFFDQCTKFLQEVSDNPS
ALSEMDEFNDGPEMMRVREKIADRLGVPYSHITHDSSEAAFYLCAYEFAIKTVNSPWCQL
FDEVDAQVMEYSNDLKQFWKRAYGYDINSKSSCILFHDVFSRLDKAANENQRGSPVTEAV
TIQIGHAETLLPLLTLLGFFKDSEPLKSENYASQAKRSFRTSHMLPYAANLVLVLYDCGE
GELRLQPLLNEKTVVFPGLSDTQSSMPLYADVKEKYKELLQGCDFETECQLFE
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagcaaagtacatttgttgcataacctgtaacgcaatgatgtccagcgactgt
aagtttgtctttttaaccactttagttattttatattcgtgcttttttggcgtgaactca
ttggatgttttcagtatccccacaatcgccaaatacttcagcaccaaggggaggtacgag
gaagtgaacccgcatctcatagaggacattctggccgtaaacacatctattattcggcct
ccttctccccagtgtcgcgaaatccacctcaccgccataatcagacatggcaccagatac
cccacgagcaaaaacgtcttaaagatgctcgagttttacgacatagtcagaaagtccgcg
gccacttcaggggacgagggctggttgcgtgagatccgagaggagtggaccatgtggtac
acggaggacatggacggccggctcgtgcagaaggggatggaggaccacaggcatttggcg
gtgagactgtccaaactgttccccaggctcatatcagaggagaaactcagaggagggctc
atcaagttcatcacaagctccaagcataggtgtgttaacagcaccctgtccttcaagagg
ggactgactgagctctggggcatcaaagacatggagtttgaccacacggtgaatgatgct
cttatgcgttttttcgaccagtgcactaagtttctgcaggaagtgagcgacaacccctca
gctttgtctgaaatggatgagttcaatgacgggccagagatgatgagagtccgggagaag
attgcagatcgcctgggagtgccctatagtcacattacacatgattcatctgaggcggcc
ttttacttgtgtgcctatgaatttgccatcaaaactgtcaactcaccctggtgtcagctt
tttgatgaagtcgatgcacaggttatggagtattctaatgacttgaagcagttctggaaa
agggcctacggctacgacatcaacagcaaatccagctgtattctcttccatgacgtgttc
agtcgactggacaaggcagccaatgaaaaccaacgtggttctccagtgactgaagctgtg
actatccagattggccatgctgagactctcttacctctccttacattactgggcttcttt
aaggacagtgaacctctcaaatctgaaaactacgcctctcaagccaaacgctctttccgc
actagccatatgctaccgtacgctgctaacctggttctggtgctgtatgactgtggagaa
ggggagctcagactgcagccgctgctcaatgaaaagactgtggtgtttccaggtttgagt
gacacccagagctcaatgcctctgtatgcagatgtgaaggagaaatacaaggagctgctg
caggggtgtgactttgagacagagtgtcaactgtttgaataa

DBGET integrated database retrieval system