KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157441
Entry
110157441         CDS       T05002                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00230  Purine metabolism
bpec00240  Pyrimidine metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110157441 (dck)
   00240 Pyrimidine metabolism
    110157441 (dck)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110157441 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 110157441
NCBI-ProteinID: XP_020777440
Position
Unknown
AA seq 263 aa
MPFTPKRSRSEDMDDSMEKRIKRISIEGNIAAGKSTFVRFLEQESSDWEVVPEPIARWCN
VQTNGSDFEELSTSQRSGGNVLQLMYEKPERWAYTFQSYACISRVRAQIRSANGKLRDAE
NPVQFFERSIYSDRYIFASNLYESECMNDTEWSVYQDWHSWLHSQFGKHIELDGIVYLRA
APEKCLERLHLRGREEEQEIPLEYLEKLHFKHESWLQHKTMSMEFEYLSDVPVLTIDVNE
DFKGNKNKGADMIEKVKEFLNTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccttttacaccgaaaagatcccgctctgaagatatggatgattcaatggaaaaaaga
ataaaacgtatctcaatcgaaggaaatattgcggcgggcaaatctacatttgtgcgattt
ttggagcaagagagctcggactgggaagtggtgccagagcctatcgccaggtggtgcaat
gtccaaaccaatggcagtgactttgaggaactgagcacttctcagagaagtggaggtaac
gtgttgcagctcatgtatgagaagccagagaggtgggcctacactttccagagctatgcc
tgcatcagtcgagtccgagctcagatccgatcagccaatgggaagcttagagatgctgag
aatcctgtccagttttttgagcgctctatctacagtgacaggtacatctttgcgtccaac
ctttatgagagcgagtgtatgaatgataccgaatggtctgtctaccaggactggcacagc
tggcttcatagtcagtttggcaaacacatagaattagacgggattgtgtacctcagagca
gctccagagaaatgcttggaacgattacatttacgaggcagagaggaagagcaagaaatc
cctctggagtatttggagaagcttcactttaaacatgagagctggctacaacacaagacc
atgagcatggaatttgagtaccttagcgatgtgcccgttttgacaattgatgtcaatgaa
gacttcaagggtaataaaaacaaaggtgcagacatgattgagaaggtgaaggagttcttg
aatacgctgtag

DBGET integrated database retrieval system