KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110158296
Entry
110158296         CDS       T05002                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00230  Purine metabolism
bpec01100  Metabolic pathways
bpec04020  Calcium signaling pathway
bpec04114  Oocyte meiosis
bpec04261  Adrenergic signaling in cardiomyocytes
bpec04270  Vascular smooth muscle contraction
bpec04371  Apelin signaling pathway
bpec04540  Gap junction
bpec04912  GnRH signaling pathway
bpec04914  Progesterone-mediated oocyte maturation
bpec04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110158296
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110158296
   04020 Calcium signaling pathway
    110158296
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110158296
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110158296
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110158296
   04914 Progesterone-mediated oocyte maturation
    110158296
   04916 Melanogenesis
    110158296
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110158296
   04270 Vascular smooth muscle contraction
    110158296
Enzymes [BR:bpec01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110158296
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 110158296
NCBI-ProteinID: XP_020778410
Position
Unknown
AA seq 1369 aa
MLEDSSNSDGANHNSPTPFTPKNLSNRKKENNFEMQDLSKTDGEINGNLDESQVLVEMGV
AKSSNANQPFFAKTVENNLDKKLPTNVNNFSSNFSSSKSSLESGDTDYGNGFEDSELQEK
SGKNSTMVHFGDTIMEDEREVESDHFGAVRASIDSAAVRWSEDGDEDGRSVLSRRSVAES
VCCCFQVLVEMGVAKSSNANQPFFAKTVENNLDKKLPTNVNNFSSNFSSSKSSLESGDTD
YGNGFEDSELQEKSGKNSTMVHFGDTIMEDEREVESDHFGAVRASIDSAAVRWSEDGDED
GRSVLSRRSVAESVCCCFQAVHRGCLRCVEETPAMLSGLVLSLCFCVALIILLTTTGRSP
DVHVGALSVVCIVLCLSTLLLVCLPWLATVRRCGGALALFVWSTLFIIAVVFIFTGGPVT
AWEQVAFFLFLSFSVYSVLPLSLAWALMVGIFTSVAHIIIISVYVPVTSPHMPDLAVQLV
ANALLFLCINCVGSYHLWATEHDLRKSNQKREEFSAIRSQKEVQKYQQEQLLLSVLPRYL
AKELKAEVISRLCKPESRGQPAAEDKNNSLFHSLYIRQHRDVSILYADIVGFTKLASTCT
PEELVAVLNKLFGRFDDIAKKNGCLRIKILGDCYYCVSGLPDPIPTHAKNCVQMGLDMCT
AIGKLREATGVDINMRVGVHTGSVLSGVIGLQKWQYDVWSHDVTLANHMESGGLPGRVHI
TEDTLMHLDGAYLVEPGNGATRDPLLQGRITYLVIDPEKPQGVPRRHKLGAKLTAEGQRQ
RASVRMSQYLQSWQTIHPFAELSNPDAKPSKKHLLRRYMGLNHPHQPQEKGPYQNDPSGR
LVVSDAVRSSLDPVDTARWRKKKLNCLTLLFNDLTLERKFRLSEVQGLHRSMTVLAVIFV
TLFAVQMLVSVKNFQMGISYGVTFPVLVLLLSITFIAYLKKWRTKLPMSLHWVYSFPTGV
SIQAALRLFVIILCVLITLTMGILNYFFQPGDNCGSITNITELQGLRLYTGPYYLYCCLL
AMLGVVVFVKTCMSVKVLLLTLAVVVYLALFLHVYEPRSVCLVNLIYNGTHKPGILKDPQ
IMSGVWLVIFYIVGFILARQDELNCRVDFLLEHCFCLEREEMETMENVNKLLLQNVLPLH
VASVFMGKNVRNQDLYSQSYESVCVMFASVPQFKEFYNESSVSKEGLECLRFLNEIISDF
DELLSKPKFSSVEKIKTIGSTYMAAAGLTAPGEERKDQSELLSSHVRAMVEFAFAIMGKL
EDRGAHSGVALCCDTPNQFSSTQVSINHGPVIAGVIGAHKPQYDIWGNTVNVASRMDSTG
VLDKIQVTEETQQKVESIGYSCTLRGVVNVKGKGELTTYFINTDHSGSI
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgctggaggattcgtcaaattcagatggagcgaaccacaactcaccaacgccttttaca
ccaaaaaatttatcaaatcgaaaaaaagaaaataatttcgaaatgcaagatttaagcaaa
accgatggagaaataaatggaaacttggacgaatcgcaggttttggtcgagatgggcgtc
gccaaatccagtaacgcaaaccaaccatttttcgccaagactgttgaaaataatttggat
aaaaaactccccacgaatgtaaataatttttcaagcaatttttcaagttcaaaatcaagt
ctggaaagcggtgatacagattatgggaatggctttgaggacagtgaattgcaagagaaa
agtggaaagaattctactatggtgcattttggcgatacgataatggaggatgagagggag
gtggaatctgaccattttggggcggttcgtgcgagtatcgacagcgccgccgtgaggtgg
tcagaggatggtgacgaggatgggcgcagtgttctgtccaggaggagcgtggctgagtct
gtctgctgctgcttccaggttttggtcgagatgggcgtcgccaaatccagtaacgcaaac
caaccatttttcgccaagactgttgaaaataatttggataaaaaactccccacgaatgta
aataatttttcaagcaatttttcaagttcaaaatcaagtctggaaagcggtgatacagat
tatgggaatggctttgaggacagtgaattgcaagagaaaagtggaaagaattctactatg
gtgcattttggcgatacgataatggaggatgagagggaggtggaatctgaccattttggg
gcggttcgtgcgagtatcgacagcgccgccgtgaggtggtcagaggatggtgacgaggat
gggcgcagtgttctgtccaggaggagcgtggctgagtctgtctgctgctgcttccaggcg
gtgcacagaggatgcctgcgctgtgtggaggagacacccgccatgttgtctgggctggtt
ctgtctctgtgcttttgtgtggccctcatcatccttctcaccaccactgggaggagtccc
gatgtgcatgtgggtgccttgtctgtggtctgtatagtcttgtgtctgagcacactgctg
ctggtgtgtttaccctggctggccacagtgaggcgctgtggaggagccctggccctgttt
gtttggagcaccctcttcatcatcgctgtggtcttcatcttcaccgggggaccagtcacc
gcatgggaacaggtggcgttcttcctcttcctgtcgttcagtgtgtactcagtcctccct
ctatctttggcctgggctctgatggttggaatcttcaccagtgtggctcacatcatcatc
atcagtgtttatgtcccagtgaccagcccccatatgccagacctcgctgtgcagctggtg
gccaatgccctcctcttcttgtgtataaactgtgttggaagttaccacttgtgggcgaca
gagcatgacctccgaaaatccaaccagaaaagagaagagttcagcgccattcgctcgcag
aaggaagtccagaaataccaacaggagcagcttcttctctctgttttgcctcggtatttg
gcgaaagagctgaaggccgaggtgatcagccgtttgtgcaaaccggagtccagaggtcag
cctgcagcagaagataaaaacaactctctcttccacagtctctacatcagacagcacagg
gacgtcagtatcctgtacgctgacattgtgggcttcaccaaactggccagtacgtgcacc
ccggaggagctggtggctgtactcaacaaactttttggacgatttgacgacattgcaaag
aaaaatggctgcctgcgcattaaaatcctgggtgactgttactactgcgtctctggttta
cctgatccaattccaactcatgccaagaactgtgtacagatgggactggacatgtgcaca
gctattggtaaattgcgcgaggcgacaggcgtggacataaacatgcgtgtgggtgtgcac
acggggagcgttctgtctggagtcattgggctccaaaagtggcagtatgatgtctggtca
catgatgtcactctggccaatcacatggagtcaggcggccttcccggtcgtgtgcacatc
acagaggacacactcatgcatctggacggagcgtacctggtggagcctggtaatggcgcg
accagagatcccctcctccagggcagaataacctacctcgtcatcgaccccgagaaacca
caaggcgttccacgcaggcacaaactgggggcaaagctaacggcagagggccagcgtcag
agagcctccgtgcggatgtctcagtatctccagtcttggcagaccatccacccgtttgct
gaactcagcaaccctgatgccaagccctccaaaaagcatcttctccggagatacatgggg
ctgaaccacccccaccaaccacaagaaaaaggcccctatcagaatgacccctctggacga
cttgttgtcagtgatgcagttcgaagttcactggatccagttgacacggcaaggtggaga
aagaagaagttgaattgcttaactctgctgtttaacgatttgactctggagagaaagttt
cggttgtcagaagttcagggtttgcacagatccatgacagttttggctgtgatctttgtc
actcttttcgccgttcagatgctcgtctctgtaaaaaacttccagatgggtatttcctat
ggagtcactttccctgttttagttttgcttctgtccatcacattcatagcatatttaaag
aaatggcgtacaaagttgccgatgagtcttcactgggtttatagttttccaaccggagtt
tcgattcaagctgctcttcgtctgtttgtgatcattctgtgtgtcctcatcaccctcact
atgggaatcctcaattattttttccaaccaggagacaactgtggctccatcaccaacatc
actgagctgcagggactcaggctctacacaggaccgtattatctgtactgctgtctgctg
gccatgctgggggtggtggttttcgtcaagacctgtatgtccgtcaaggtgctattgcta
acgttagcggtggtcgtgtatctggccctgtttcttcacgtttacgagccgagatctgtc
tgcctcgtcaacctgatctacaacggcacgcacaagccgggaatcctcaaagaccctcag
atcatgtctggagtttggcttgtcatcttctacattgtggggttcattttagccagacag
gatgagctgaactgccgcgtggacttcctgttggagcactgtttttgtttggagcgagag
gagatggagactatggaaaacgtgaacaaacttctactccagaacgtcctcccgctgcac
gtagcctcagtgttcatgggaaaaaacgtcagaaaccaggacctgtacagccaatcgtac
gagagtgtgtgtgtgatgtttgcctccgtaccccagtttaaagagttttataacgaaagc
agcgtcagtaaagaggggctggagtgtctgcgcttcctcaacgaaatcatctccgacttt
gacgagctattgtccaaaccaaagttcagttcagtggaaaagattaaaaccatcgggagt
acgtacatggctgcagccggtctcactgcccctggagaggagaggaaggaccagtctgag
ctgctgtcctcccatgtgagagccatggtggagttcgccttcgctataatggggaaacta
gaggatagaggggcccacagcggcgtggctctttgttgtgacactccaaatcagttttct
agcacgcaagtcagtataaaccatggtccggtgatagcaggggtcataggagctcacaaa
ccacaatacgacatttggggaaacactgtgaatgtggccagtcgaatggacagcaccgga
gtcctggacaaaatacaggtgactgaggagacacagcaaaaggtggagagcattggatac
agctgcactttacgaggagttgtgaacgtgaaaggaaaaggagaactgactacgtacttt
atcaatacagaccacagtggatcaatatga

DBGET integrated database retrieval system