KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159012
Entry
110159012         CDS       T05002                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
bpec04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110159012 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110159012 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 110159012
NCBI-ProteinID: XP_020779234
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTEHGRELEETATVRKLVPPNPVRTGQSHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacagagcatggcagggagttggaggagacagccacagtg
agaaagctggtgccaccaaacccagtgcggaccggtcagagtcacagaccagccggctgg
aaacggagacgtccacgacctcgtctgtcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system