KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159085Help
Entry
110159085         CDS       T05002                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04060  Cytokine-cytokine receptor interaction
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
bpec04218  Cellular senescence
bpec04350  TGF-beta signaling pathway
bpec04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110159085 (tgfb2)
   04350 TGF-beta signaling pathway
    110159085 (tgfb2)
   04068 FoxO signaling pathway
    110159085 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110159085 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110159085 (tgfb2)
   04218 Cellular senescence
    110159085 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110159085 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bpec04052]
    110159085 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:bpec00536]
    110159085 (tgfb2)
Cytokines and growth factors [BR:bpec04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110159085 (tgfb2)
Glycosaminoglycan binding proteins [BR:bpec00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110159085 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 110159085
NCBI-ProteinID: XP_020779304
Position
Unknown
AA seq 424 aa AA seqDB search
MLIRTSTQNWKNTVKMNPSLHLVLLVLDLLALSAALSTCSTLDMDEFRKKRIEAIKGQIL
SKLKLSRPPEEYPEPEEVSRDVVAIYNSTRDLLLEKANERAATCERQRSEEEYYAKEVHK
IDMLPFYPAENVISPTLLNPFYRRLSFDVSSMEKNASNLVKAELRIFRLQNPGARVPEQR
IELYQVLSHKALASPTQRYIDSRVVRTQTEGEWLSFDVTEVVSEWLNHRDRNSGFKLSLH
CPCCTFVPSNNLIIPNKSEELEARFAGIDDSFDLKMFKKRRHSTRAPHLLLMLLPSYRLE
SQTQHKPYRAKRALDAAYCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGAC
PYLWSADTQHSKVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKS
CKCS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctcataagaacttccactcagaattggaaaaacacagtgaagatgaatccgagcctc
catctcgtgctgttggttctggacctccttgctctctccgctgccctctccacctgcagc
accctggacatggacgagtttaggaagaagcgcatcgaggccatcaagggtcagatcctg
agcaaactgaagctgagccgcccgcccgaggagtaccccgagcccgaggaggtgtcccgg
gacgtggtggccatctacaacagcacccgcgacctgctgctggagaaggccaacgagaga
gcggccacgtgcgagaggcagaggagcgaggaggagtactacgccaaagaggtgcacaag
attgacatgctgccgttctaccccgccgagaacgtgatttctccgacgctgttaaacccg
ttctaccgccggctctccttcgacgtgtcctccatggagaagaacgcctcaaacctcgtc
aaagcagaactcaggatcttcaggctccagaaccccggagccagagtcccagagcagcgc
atagaactctaccaggtcctgtcacacaaagcgctggcgtctcccacacagaggtacatc
gacagcagagtggtgcgcacgcagaccgagggggagtggctttccttcgacgtcaccgag
gtggtcagcgagtggctcaatcacagagacaggaacagtgggtttaagctgagcctgcac
tgtccctgctgcaccttcgtcccctccaacaacctcatcatccccaacaagagtgaggag
ctggaggcgcgcttcgcaggtatcgacgacagttttgacctgaaaatgtttaagaagcgc
agacacagcacccgggcccctcacctgctcctgatgctgctgccctcctacagactggag
tcccagacgcagcacaaaccctacagggccaagagggcgctggacgcagcctactgctcc
aggaacgtccaggacaactgctgcctgcgctcgctctacatcgacttcaagaaggacctg
ggctggaggtggatccacgagccaaagggctacgaggcaaacttctgcgccggagcctgt
ccgtatctgtggagcgccgacacgcagcacagcaaagttttaggtttgtacaacacgata
aaccccgaggcgtccgcgtctccgtgctgcgtgtcccaggacctggagcccctcaccatc
ctctactacatcggaaaaacgccaaagatcgaacaactctccaacatgaaagtcaagtcc
tgcaagtgcagctag

DBGET integrated database retrieval system