KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159352Help
Entry
110159352         CDS       T05002                                 

Gene name
zdhhc21
Definition
(RefSeq) palmitoyltransferase ZDHHC21
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110159352 (zdhhc21)
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110159352 (zdhhc21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 110159352
NCBI-ProteinID: XP_020779565
Position
Unknown
AA seq 265 aa AA seqDB search
MKLRLHFVVDPMGWLCISVVFGIWLYNSFFVPKLVLLPHYNEGHIPWAIVVCYYIASALC
FAALFRASTADPGRLPVDPHIPHSEREHWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYAQVLSLFTLVLDFCQYYYFQPLTQLDQEKFTTRHELALL
RVSALMGVVMFGGMTSLFYTQMTGILSDTTTIEKMSQFSNDMLNSKKKWQRALAEVCGTR
WKLLWLLPLRARQPLQSGHHYRSHV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacgactacattttgtggtggaccccatgggctggctctgcatcagtgtggtg
tttggcatctggctctacaattcattttttgtccctaaacttgttctacttccacactac
aatgaaggacacataccttgggccattgttgtttgttattacatcgcatctgcattgtgc
tttgcggccctgttcagagcttccacagcagaccccggtcgtcttcctgttgaccctcat
atacctcattctgagcgagaacactgggagctgtgcaataaatgtaacttaatgagacca
aagaggtcgcatcactgcagccgctgtggccactgtgttcgcagaatggaccatcactgt
ccttggattaataactgtgtgggagaagacaaccattggctcttcctccagctttgtttt
tatgctcaggttctcagcttgttcactcttgtgctggacttctgccagtactactacttc
caacccctgacacaactggatcaggagaaatttacaacacgacatgaactggctttgctg
cgagtttcagcgctcatgggagtggtcatgtttggtggcatgaccagtttgttctacact
caaatgacaggaatcctttcagatacaacaactatagagaaaatgtctcagttctcaaat
gacatgttaaattcaaagaagaagtggcagagggcgttggctgaggtctgtggtactcga
tggaaactgctgtggctgcttccactcagagcgaggcagcctctccagtcaggacaccat
taccgctcccacgtttag

DBGET integrated database retrieval system