KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159594Help
Entry
110159594         CDS       T05002                                 

Gene name
prodh2
Definition
(RefSeq) probable proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00330  Arginine and proline metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110159594 (prodh2)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     110159594 (prodh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 110159594
NCBI-ProteinID: XP_020779825
Position
Unknown
AA seq 463 aa AA seqDB search
MLGSRVCLSWPLLLPLRQVGTTTARTMTAARNPELLSTTLAFEDPRAFQVKTMGELLRAL
GVFRLCSFPWLVNNCGTLMSIARRILGKRGFSLFVRPTVYAQFVAGENETEISHSMQKMS
LLGLRPMLAVPIEEDLGESTGEKRYEDNMETMLECVRMSHGNAWSKDPMMQLKVTALLSP
ELCVKLTTLLAQQPYDLNQLVRAMDGEPFSFHGLDEKENAHLLCGLRRLNKIAEASVNKV
RVLVDAEYTYMNPALSLVTIAMMKKFNKNGAWIWNTYQCYLKESRSLIQEAISLSKKEGF
CLGVKLVRGAYMDKERKLAQKEGRQDPIHNSWENTNDSYNDSLNAMLEMISQQPERYRII
VATHNEKSVRLAVQRMEELSIDKDSGSVCFGQLLGMCDHVSLTLAKEGYAIYKSVPYGSV
DDTLPYLVRRAQENRTVLQGIRKERDLLRQELRRRLRHRLNTA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctggggtctcgtgtgtgcctctcgtggcctctcctcttgcccctccggcaggtaggt
acaaccacagccaggacgatgactgcagccagaaacccagagctgctgtctaccactctg
gcctttgaagaccccagggcctttcaggtgaagaccatgggagagctactgcgtgcactg
ggcgtcttccgcctctgctccttcccttggctggtcaataactgtggcacgttgatgtcc
attgctcggagaatcctgggaaagagaggcttttccctgtttgtgcgacccacagtgtat
gcacagtttgtggctggagagaacgagacagagatatcccactccatgcagaagatgagt
ttgttgggactgaggccgatgctggcagttcccattgaggaagatctgggagaaagcact
ggggagaagaggtatgaggacaacatggagactatgctggagtgtgtccgcatgtcccac
ggtaacgcatggagcaaagaccccatgatgcagctgaaagttactgctctgctcagtcca
gagttgtgtgtgaagcttacgacacttttggcacaacaaccatatgaccttaatcagctg
gtcagagccatggacggagagccattcagtttccatggtttagatgagaaggagaatgca
catttactttgtggactgagacgactcaacaaaattgcagaggccagtgttaacaaagtt
cgagtcttggttgacgcagagtacacctacatgaacccagccctctctctggttaccata
gcaatgatgaaaaaatttaacaaaaatggtgcctggatttggaacacataccaatgttat
ctcaaggagtccaggtccctgatccaagaagccatcagtctttcaaaaaaggagggattc
tgcctgggggtcaaacttgtgagaggagcctatatggataaagagcggaaacttgcacag
aaggagggcagacaagaccctattcataactcctgggaaaatacgaatgacagttataat
gactcacttaatgccatgctggagatgatctcacaacaacctgaacgctacagaatcatt
gtggccacacacaacgagaagtcagtcagactggctgtacaaaggatggaagagctaagc
atagacaaagacagtggctcagtttgttttggtcagttgctgggcatgtgcgaccacgtc
tcccttactctggctaaagagggttatgccatttacaagtctgtaccgtacggctctgtg
gatgacaccctcccatacctggtgcgtagggctcaggagaatcgcacggtactgcaggga
atccgcaaagagagagacctcctaaggcaggagctgcgccgaagactgagacacagactg
aacactgcataa

DBGET integrated database retrieval system