KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159816Help
Entry
110159816         CDS       T05002                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00071  Fatty acid degradation
bpec01212  Fatty acid metabolism
bpec03320  PPAR signaling pathway
bpec04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110159816
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110159816
   03320 PPAR signaling pathway
    110159816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpec03029]
    110159816
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110159816
Mitochondrial biogenesis [BR:bpec03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110159816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3852
Motif
Other DBs
NCBI-GeneID: 110159816
NCBI-ProteinID: XP_020780081
Position
Unknown
AA seq 789 aa AA seqDB search
MAEAHQAVAFQFTVTPEGIDLQLSHQALSEIYLSGVRSWKKRIIRLKNNVITGVYPASPS
SWLFVVIAILATMYTRSDPSMGLIAKIQEHLPVSQSMSSQCQAVVSAVLFSTLLWLLLIF
TMRLCLKQLLSYHRWMFEQHGKMSNTTKVWVALVRIFSGRKPLLYSYQGSLPNLPVPTIK
DTVKRYLESVRPLMDDSKYERTTKLAEEFQGSLGNRLQWYLKLKSLWAANYVSDWWEEYV
YLRGRSPIMVNSNYYGMDFLFVTPTPIQAARAGNSIHAFFLYRRKLNKEEIKPSRIPGTV
IPLCAAQCERIFNTTRTPGEETGKETLVCNIKNFRHLSVYHRGRYFRLRVYQAGRLLSPR
EIEFQIQRILDDPSPPSKGEVHLGALTAGDRIPWAKARAKFFSTGLNKRSLDCIEKAAFF
VTLDDDEQGMMGDDPAASLDKYAKSLLHGKCYDRWFDKSFSVVFYKNGKCGINAEHSWAD
APVLAHVWEYALATDSFQLGYNTEGHCKGEVDSSLPKPQKLNWEIPPECEEQISKSLEVA
QKLANDIDFHVFSFQEFGKGKVKKCRVSPDAFIQMTLQLAYFREQGNFCLTYEASMTRLF
REGRTETVRSCSNESSAFVRAFEGGEVSQKVCRRLFRAASEKHQLLYRMAMTGAGIDRHL
FCLYVVSKYLGIESPFLKEVLSEPWRLSTSQTAVQQVELFDLVNYPEYISCGGGFGPVAD
DGYGVSYSLVGENIINFHISCKHSCPQTDAHKFGSQIKRALHDILHLLSGAQPEPKKTEA
SHPNVKKDQ
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgcaccaggccgtggcgttccagttcacagtcactcctgagggcatcgac
ctgcagctgtcccaccaggcgctctctgaaatctacctgtccggagtacggtcctggaag
aagcgcatcattagactcaagaacaacgttataacaggagtttacccagccagtccgtct
tcatggttatttgtggtcattgcaattttggctacaatgtacacccgctctgatccatcc
atgggactcatagccaaaatacaagagcacctaccagtcagtcagtcgatgagttctcag
tgtcaggctgtggtgtctgcagtgctcttcagtactctgctgtggctactgctcatattc
accatgagactctgccttaaacagctcctatcctaccaccgctggatgtttgagcagcat
ggaaagatgtccaacaccaccaaagtctgggtggccctggtgcgcatcttttctggcagg
aagcctcttctctacagctaccagggttcactgccaaacctgcctgtgcccaccattaaa
gacactgtcaaaaggtacttggagtctgtgcgtcctcttatggatgacagtaaatatgaa
cgcacaaccaaactagcagaagagtttcagggcagcctggggaaccgcctgcagtggtac
ctcaaacttaaatcactctgggctgctaactatgtcagtgactggtgggaagaatatgtt
taccttcgtggaagaagccctataatggtcaacagtaactactatggcatggattttttg
tttgtgacgcccacaccgatccaggcagcaagagctggcaactccattcacgcattcttc
ctttatcgtcgcaaactgaacaaagaggagattaaaccaagtcgtatccccggcactgtc
attcccctgtgtgcagctcagtgtgagaggatattcaacactacacgtactccaggagag
gagactggtaaagagacactcgtttgcaacattaaaaatttcagacatttatccgtatac
cacagggggcgctacttcaggctcagggtgtaccaggctggccgccttctgtcacccaga
gagattgagtttcaaatccaaaggattctggatgacccctctcctccttcaaaaggagaa
gtccaccttggggccctgacagctggtgacagaataccatgggccaaggccagggcaaaa
ttctttagcacagggcttaacaaacggtctctggactgtatagaaaaagctgcctttttt
gtcacactggatgatgatgagcaaggcatgatgggtgatgaccctgctgcaagtctagat
aaatatgctaaatcccttttacatggaaaatgttatgacaggtggtttgacaagtcattt
tctgtggttttctacaaaaatggaaaatgtggtataaatgcagaacattcttgggcagat
gcaccagttttagctcatgtatgggagtacgccctggctactgacagtttccagcttggt
tacaatacagaaggtcactgcaagggagaagtggattcttcacttccaaaaccacagaag
ctgaactgggaaatccccccggagtgtgaggagcagatctcaaagtctttggaagtggcc
cagaaactggcaaacgatatcgattttcacgttttctcattccaagagtttggaaaagga
aaggttaaaaagtgcagagttagcccagatgcctttatacagatgactcttcagttggcc
tacttcagggagcaaggtaatttctgcttgacgtatgaggcctccatgacccgtctgttc
agggagggcaggactgagacggtgcgctcctgctccaatgagagcagtgcctttgtccga
gcgttcgaaggaggagaggtgagtcaaaaggtgtgcagacgtctgtttcgagcagcgtcc
gaaaagcaccagcttctgtatcgcatggccatgacaggagctggcattgacagacatctc
ttctgcctctatgtggtctctaaatatctgggaatagagtcgcctttcttgaaagaggtg
ctgtcagagccctggaggctctcaaccagtcagactgctgtccagcaggtggagctgttt
gacctggtcaactacccagaatacatctcttgtggaggaggctttggcccagttgctgat
gatggttatggagtgtcctacagccttgttggagagaacattatcaacttccacatctcc
tgcaagcactcgtgtccccaaactgatgcccataaatttggttctcagattaaaagggca
ctgcatgatatacttcatctgctcagtggtgcccaaccagagcccaagaaaactgaagcc
agtcaccctaatgttaagaaagaccagtaa

DBGET integrated database retrieval system