KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159887Help
Entry
110159887         CDS       T05002                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110159887
   04020 Calcium signaling pathway
    110159887
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bpec04040]
    110159887
Ion channels [BR:bpec04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110159887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2 GRP
Motif
Other DBs
NCBI-GeneID: 110159887
NCBI-ProteinID: XP_020780149
Position
Unknown
AA seq 1753 aa AA seqDB search
MVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVVKMVALGIFGQRCYL
GDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTL
PMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEENFTLSAGLTLPAPYYRPEEDDER
PFICSLASENGIMSCTDVPARREGGRTCCLDKEDALHRQALGLSPEPVANASAGEALGLC
INWNQYYTRCHTGNTNPHKGAINFDNIVYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFI
YFILLIIIGSFFMINLCLVVIATQFSETKQREHQLMQEQRAQCLSSSTLASMTEPGDCYE
EIFQLVCHILRKAKRRSAALYYSLRGQTPPATAGRANRRPAGGAAGGGGNTGRERHQARQ
QKVCRCPRPTKQTHDSQPLANSVSVALPDDAEECPVCSLSLKERTKTADEEDGEDEETAV
KETDRDDHPEDQVPRKKRRRTCLGHCKNLWTDIRRKLWGIVESKYFSRGIMIAILINTIS
MGIEHHNQPEELTNVLEICNIVFTSMFTLEMILKLTAFGFFEYLRNPYNIFDGIIVIISL
CKLAMQXDGGLSVLRTFRLLRVIKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIF
SILGMHIFGCKFSLKTEAGDTVPDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSP
CAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDDDRSSCNFEENDKLKDSLH
LSDPKICTLTPNGHLDVSALPPGLFPGDKWTYALNSRKNSVISLCNLDQRAVYPGRGYHN
WGRPLPPHHQHLWARRASWNSMGGVRPCSASSPSSSPAYTPNPTPTSTPKLIYSYGYGPG
NVMGGSLRIRGPRASSSPHRHVPRGRQDEEEEESLLSPPSLHHLSPPLLSGQLGPRRDRR
ALSLELPNLLQVPDQVLTTLPNPYAQSHAHNQLRTEVYPQVNARTKDREDMDDDIEYSLC
FRIQKMLEAYKPDWCETREDWSVFLFSPQNKFRLMCQSIIAHKLFDYVVLAFIFSNCITV
ALERPKILQGSLERVFLTVSNYIFTAIFVGEMTLKVVSMGLYMGEQAYLRSSWNVLDGFL
VFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNI
VLICCAFFIIFGILGVQLFKGKFFYCYGPDTKNITNKSDCLEANYKWVHHKYNFDNLGQA
LMSLFVLASKDGWVNIMYHGLDAVGVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVGV
VVENFHKCRQHQEVEEAKRREEKRQKRMEKKRRKAQRLPYYSSYGRVRLMIHTLCTNHYL
DLIITFIICINVITMSLEHYNQPHSLDLALKYCNYFFTSMFVLEAVLKLIAFGFRRFFKD
RWNQLDLAIVLLSVMGITLEEIEISAALPINPTIIRIMRVLRIARVLKLLKMATGMRALL
DTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNEDYPCEGMSRHATFENFGMAFL
TLFQVSTGDNWNGIMKDTLRECPPDHGTELEYACNPSLQFISPMYFVSFVLTAQFVLINV
VVAVLMKHLDDSNKEAQEEAEMDAEIELELAQGTLCCMGAPGCGGGGGGGGGGGSGAGGP
VVVSERAKEKTSRPAESQWLDSVSLLMKDSLEGEMQMIDNLSGSVFHHYSSPPLCKGCKG
HPQEVLPRHRSPV
NT seq 5262 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcctgctcaactgtgtgaccctgggcatgtaccagccctgcgaaaacatcgac
tgcacctccgaccgctgccagatactgcaggccttcgatgcgttcatctacatcttcttc
gcgttggagatggtggtgaagatggtcgctctggggatcttcgggcagcgctgttacctc
ggagacacgtggaaccgactggacttcttcatcgtcatggcggggatggtggagtactcc
ctggacctacagaacatcaacctgtccgccatcaggacggtgagggtactgcggccactc
aaagccatcaacagagtgccaagtatgcgcatcctggtgaacctcctcctggacacgctg
cccatgctggggaacgtgctcctcttgtgcttcttcgtcttcttcatcttcggcatcatc
ggcgtgcagctgtgggcggggctactgaggaaccgctgctaccccgaggagaacttcacc
ctctcggcaggcctgaccctccccgccccgtactaccgcccggaggaggacgacgagagg
cccttcatctgctcgctggcgtcggagaacgggatcatgtcgtgtacagacgtgcccgct
cggagggaggggggccggacctgctgcctggacaaagaggacgccctccacaggcaggcg
ctggggctgagtccggaacccgtggccaacgcgagcgccggagaagctctgggcctgtgc
atcaactggaaccagtactacacgcgatgccatacggggaacaccaacccacacaagggc
gccatcaactttgacaacatcgtgtacgcttggatagtcatttttcaggtgatcactctg
gagggctgggtggagatcatgtactacgtgatggacgctcactccttctacaacttcatc
tacttcatactactcatcattatcggctccttcttcatgatcaacctgtgcctggtagtc
atcgccacgcagttctcggagacgaagcagcgcgagcaccagctgatgcaggagcagagg
gcccagtgcctgtcctcgtccaccctggccagcatgaccgagccgggggactgctacgag
gagatcttccagctggtctgccacatcctgcgcaaggccaagaggaggtcagccgcgctc
tactacagcctgagggggcagactccgccggccacagcgggcagggccaaccggcgacca
gcagggggagcagcaggaggaggggggaatactgggagagagagacatcaagccaggcaa
cagaaagtttgccgatgcccacgcccgaccaaacagacccacgactcccagcccctggca
aactccgtcagcgtggctttacccgacgacgccgaggagtgccccgtctgctccctgtcc
ctgaaagagaggaccaagaccgcagacgaagaggacggagaggacgaggagacggctgtc
aaggagacggaccgcgacgaccacccggaggaccaggtcccgaggaaaaagaggaggcgc
acctgtttgggacactgtaaaaacctctggacggatataaggaggaaactgtgggggata
gtggagagcaagtacttcagccgggggattatgatcgctattctgatcaacacgatcagc
atgggaatcgagcatcacaaccagcctgaagaactgaccaacgtcctggagatctgtaac
atcgtcttcaccagcatgttcacgctggagatgatcctcaagctcaccgcgttcggcttc
ttcgagtatctgaggaacccctacaacatctttgacggcatcatcgtcatcatcagttta
tgcaaattagccatgcagnnngacggcggcctctccgtgctccggaccttcaggctcctc
agggtcataaagctggtgaggttcatgccggcgctgaggagacagctcgtggtcctcatg
aagaccatggacaacgtggccaccttctgtatgctcctcatgctcttcatcttcatcttc
agtattctggggatgcacatcttcggctgtaagttcagtctgaagacggaggctggagac
accgttcctgaccgcaagaacttcgactcgctgctctgggccatcgtcactgtctttcag
attctgactcaggaggactggaacatggtcctgtacaacggcatggcctccacgtctccc
tgcgccgctctgtacttcgtcgccctcatgacctttgggaactacgtgctcttcaatctt
ctggtcgccatcttggtcgagggatttcaagctgagggcgacgccaaccgctcgtactcg
gatgatgacaggtcctcttgtaatttcgaggagaatgataagctcaaggactctctgcat
ctgtcagacccaaagatctgcactctgaccccgaacggtcacctggacgtgtcagccctg
ccccccggcctgttccccggagacaagtggacctacgccctgaactcccgcaaaaacagc
gtcatctctctctgcaatctggaccagagagctgtgtatccaggccgaggttaccacaac
tggggtcgcccgctcccccctcaccatcagcacctctgggcccgccgcgccagctggaac
agcatgggcggagtcagaccgtgctccgcctcctcgccctcctctagccccgcctacacg
ccgaaccccaccccgacctccaccccgaagctcatctacagctacggctacggccccggc
aacgtcatgggcgggagtttgcggatccgcgggccccgagcgtcctcctccccgcaccga
cacgtcccgcgcggtcgacaggacgaggaagaggaggagtcgctgctgtcgccgccctcc
ctccaccacctgtccccgcccctgctgtcggggcagctggggcccaggagagatcgcaga
gcactgtccctagaacttccaaacctgctgcaagtgccagaccaagtgctaaccactctg
ccaaacccatatgcacagagccacgcccacaaccagctccgcaccgaggtctacccccag
gtcaacgcccgcaccaaggaccgagaggacatggacgacgatatcgaatacagcctgtgt
ttcaggatccagaagatgctggaggcttacaaaccagactggtgtgaaacccgagaggac
tggtctgtcttcctcttctctcctcagaacaaattccgcctgatgtgccagtccatcatc
gcgcataagctctttgactatgtggttttggctttcattttctccaactgcattaccgtg
gctctggagaggcccaagatcctgcagggtagcctggagagagtgttcctcaccgtctcc
aactacatctttacggccatctttgtgggagagatgactctaaaggtggtgtccatgggc
ttgtacatgggggagcaggcctacctcaggagcagctggaacgtcttggacggtttcctg
gtgttcgtgtccctcatcgacatcgtggtgtccatggcgggaggggccaagatcctcggg
gtccttagggtgctcaggctgctgcggacactgcgcccactcagggtgatcagcagagct
cctggtctgaagctggtggtggaaaccctcatcacgtctctcaaacccatcggaaacatc
gtcctcatctgctgcgcgttcttcattatctttggcattctgggagtacagctgttcaaa
ggcaagttcttctactgctacggcccggacaccaaaaacatcaccaacaagtccgactgc
ctggaggccaactacaagtgggtccaccacaagtacaactttgacaacttgggacaggcc
ctgatgtctctgtttgtcctggcgtccaaagacggctgggtgaacatcatgtaccacggg
ctggacgctgtgggcgtggaccaacagcccgtcaccaacaataacccgtggatgctgctg
tacttcatctccttcctcctcatcgtcagcttcttcgtgctcaacatgttcgtgggcgtg
gtggtggagaacttccacaagtgcagacagcatcaggaggtggaggaggccaagagacga
gaggagaagaggcagaagcgcatggagaagaagagaaggaaagcccagcggttgccgtac
tactcgagctacggccgcgtgcgcctcatgatccacacgctgtgcaccaaccactacctg
gacctcatcatcaccttcatcatctgcatcaacgtcatcaccatgtccctggagcactac
aaccagccccactctctggatctggccctgaagtactgtaactacttcttcacttccatg
tttgtgctggaggcggtgctcaagctcatcgcgttcggcttccggcgcttcttcaaggac
aggtggaaccagcttgacctggccatcgtgctgctgtcagtcatgggcatcacgctggag
gagattgaaatcagcgccgctttgcccatcaaccccaccatcatccgcatcatgagagtg
ctgaggatcgccagagtgctgaagctgctcaagatggccaccggaatgagagccctcctg
gataccgttgtccaagccctgcctcaggtgggtaacctgggcctgctcttcatgctactg
tttttcatctacgccgccttaggagtggagctgtttggagaacttgtttgtaatgaagac
tacccgtgtgaggggatgagtcgtcacgctacttttgagaactttggcatggcctttttg
accctgttccaagtgtccacgggcgataactggaacggcataatgaaggacacgttgcgc
gagtgcccgcccgaccacggcacggagctggagtacgcgtgcaacccgagcctgcagttc
atctcgcccatgtactttgtctccttcgtgctcaccgcccagttcgtgctcatcaatgtg
gtggtggccgtgctgatgaagcacctggacgactccaacaaggaggcccaggaggaggcg
gagatggatgcagagattgagctggagttggcccagggcaccctctgttgcatgggcgcc
cccggatgcggaggcgggggtggcggaggaggaggaggaggtagcggcgcaggagggccg
gtggtggtctccgagagggcgaaggagaagacgtccaggccggcggagagccagtggttg
gacagcgtgtctctcctcatgaaggactctctggagggggagatgcagatgatcgataac
ctgtctggctctgtgttccaccactactcctctcctccgctctgcaaaggctgcaagggc
cacccgcaagaggtactcccgaggcaccgctcacctgtttga

DBGET integrated database retrieval system