KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110159954Help
Entry
110159954         CDS       T05002                                 

Gene name
ddx18
Definition
(RefSeq) ATP-dependent RNA helicase DDX18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bpec03041]
    110159954 (ddx18)
   03009 Ribosome biogenesis [BR:bpec03009]
    110159954 (ddx18)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110159954 (ddx18)
Spliceosome [BR:bpec03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    110159954 (ddx18)
Ribosome biogenesis [BR:bpec03009]
 Eukaryotic type
  90S particles
   Helicases
    110159954 (ddx18)
  Pre-60S particles
    110159954 (ddx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_22 NOA36
Motif
Other DBs
NCBI-GeneID: 110159954
NCBI-ProteinID: XP_020780210
Position
Unknown
AA seq 621 aa AA seqDB search
MADLQMKLLRKKIQKRNDKNKERKLKQKSQDQDGDPGTCVCPAGFRVFRVSGACDLASLA
PALPQTCPRNMEKKTKPSEGDDEDDEEEEDEEEEADGEKSGAERGPEVEEEELPELPSGL
TGAFEDTSFSSLSELVSENTLKGVKEMGFEHMTEIQHKTIRPLLEGRDMLAAARTGSGKT
LAFLIPSIELIYKLKFMPRNGTGVVILSPTRELAMQTYGVMKELMTHHVHTYGLIMGGSN
RSAEAQKLANGVNILVATPGRLLDHLQNTPGFMFKNLQCLIIDEADRILEVGFEEELKQI
IKLLPKKRQTMLFSATQTRRVEDLARISLKKEPLYVGVDDNKDNATVDGLEQGYVVCPSE
KRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYIDLPVMAIHGKQKQTKRTTTFFQ
FCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGINGRGHALLIL
RPEELGFLRFLKQAKVPLSEFEFSWSKISDIQSQLEKLIEKNYYLHKSAQEAYKSYVRAY
DSHSLKQIYSVNTLNLPMVALSFGFKVPPYVDLNVHSGKGAKLQKRGGGGGFGYQKSKNI
HKAKIFKHVNKGKRDQRQFSR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctccagatgaagctgctccgcaagaaaatccagaaaagaaacgacaagaac
aaagagaggaaactgaagcagaagagccaggaccaggacggagacccgggtacgtgtgta
tgtcccgcggggtttcgggtgtttcgtgtgtccggcgcgtgcgacctagcctcgttagct
ccagctctgccacaaacgtgtccaagaaatatggagaagaaaaccaaaccctctgaagga
gacgatgaagatgatgaagaagaagaggacgaggaggaggaggcggatggagagaagtca
ggagctgagcgaggacctgaggtggaggaggaggagctgcccgagcttccatctggactc
acaggagcgttcgaggacacgtctttctcgtctctgtccgagctcgtcagtgagaacacg
ctcaaaggagtcaaggagatgggcttcgagcacatgaccgagatccagcacaaaaccatc
cgcccgctgctggaggggagggacatgttggccgccgcgaggacgggcagcgggaaaact
ctggccttcctcatcccctccatcgagctcatctacaaactcaagttcatgcccaggaac
ggcactggtgtggtgatcctgtcccccactcgggagttggccatgcagacgtacggcgtc
atgaaggagctcatgacccaccacgtgcacacgtacggcctcatcatgggcggcagcaac
cgctcggccgaggcgcagaaactcgccaacggagtcaacatcctggtggccacgcccggg
agactgctggaccacctgcagaacacgcccggcttcatgttcaagaaccttcagtgtctg
atcatcgacgaggccgaccgcatcctggaggtcggctttgaggaggagctcaagcagatc
atcaaactcctgcccaagaagaggcagacgatgctgttctcggccactcagactcgccgc
gtggaggatctggctcgtatctcgctgaagaaggagcctctgtacgtgggcgtggacgac
aacaaggacaacgccacagtggacggactggaacagggctacgtggtgtgtccctcagag
aagcgcttcctgctcctcttcacgttcctgaagaagaaccgaaagaagaagctgatggtg
ttcttctcctcctgcatgtccgtcaagttccactacgagctcctcaactacatcgacctg
cccgtcatggccatccacgggaagcagaagcagaccaagcgcaccaccaccttcttccag
ttctgtaacgcagactctgggatcctgctgtgcacagatgtggcagctcgaggcctggac
atccccgaggtcgactggatcgtccagtacgacccccccgatgatcccaaggagtacatc
cacagagtcggcagaactgctcgagggatcaacggccgaggccacgccctcctcatcctg
cgcccagaggagctcgggttcctgcgcttcctcaagcaggccaaggtgccgctgagtgag
tttgagttttcctggagtaagatctcagacatccagtctcagttggagaagctcatagag
aagaactactacctgcacaaatctgcccaggaggcctacaagtcgtacgtccgggcctac
gactcccactcgctcaagcagatctacagcgtcaacaccctcaacctccccatggtggcg
ctgtccttcggcttcaaagtgcccccgtacgtcgacctcaacgttcacagcggaaaaggc
gccaagctgcagaagcgcggaggaggcggcggcttcgggtaccagaagtccaagaacatc
cacaaggccaagatcttcaaacacgtcaacaaaggcaagagggaccagagacagttctcc
cgctag

DBGET integrated database retrieval system