KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160123Help
Entry
110160123         CDS       T05002                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpec04131]
    110160123 (dock7)
Membrane trafficking [BR:bpec04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110160123 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 110160123
NCBI-ProteinID: XP_020780408
Position
Unknown
AA seq 2171 aa AA seqDB search
MAERRAFAQKINRTVAAEVRKQISGQYGGSPQLFKHPNAGTAASNTVPLTEAVDPVDFEE
YLITHPPIVESGPLRDLIEFPPDDIEVIYTPRECRTVVQAVPEEGDTDAHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNALDKQKERQKGLPKQIFEADEMPETSSYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDPLLPHLLDRAPNEEIDRHNEDQRKTSRHRELFALHPAL
DEEEPIERHCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFFF
DLNSEQTKAMLRPHIQTAAISTLARSAVFSITYPSQDVFLVIKLEKVLQQGDIGECAEPY
MVFKESDAAKNKEKLEKLRSQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTEME
MSLSERKGSWSERRNSSIMGRRSLERTTSGDEACSLTGFRPATLTITNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLLQVKPYPDSRVRPTR
EILEFPARDVYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPNNAMPVIF
GKSSCADFYKEAYTSVVYHNRSPDFSDEVKIKLPASLSDHHHILFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
VTAVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENSLEAELKTSIAALNSAQLE
PVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQASFEVMASIVNRLHKYLDTSQDMHGRNS
LLSSYIHYVFRLPSTDPNSPSPDSDSASTGPGGLGGSMHYATMARSAVXXXXXXXXXXXX
XXXXXXXXXXSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVHSMGCNSDPWGS
SPGSAPETMQAMERCGNRMSSHTESSSFLQSLTGRLPTKKLFHEELALQWVVSSGSVREG
ALQQAWFFFELMVKSIIHHLYFTDRLESPRKHRFPERFMDDITALVSTIAGDIVSRFQKD
LELVERLNTSLAFFLNDLLSVMDRGFVFTLIRAYWKQVSTKLYNLQNPTLESLRLDFLRI
VCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQH
FLAGLVLSELSVILEPENEVMFGLHKKVVNVVHNLLSSHDSDPRYADPEVKGRVAMLYLP
LIGIVMEALPQLHDFTESHNQWGRPGAPPGAAVSSSGEEAESEANIINQTVAMAIAGTST
ASPMSRPSSFMLNSQTPRQHGSFSAESSRSLLICLLWVLKNADELVLQKWFTDLSVTQLN
RLLDLLYLCVSCFEYKAHVVFTMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQE
MVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNSEKLDKSHRSVRTRAELEHEALID
GNLATEANLIILDTLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQR
ALVSKFPELLFEEETEQCADLCLRLLRSCSSSISTIRSHASASLYLLMRQNFEIGNNFAR
VKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMI
LSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLV
HSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEI
GLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFGKIVHQS
TGWEDGKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQ
VEVIKDSNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTL
DGRAHGDLHEQYKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAF
ATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFT
KRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKPVLQVNAHRDS
FSRLSLRKLDI
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgccgcgccttcgcacagaaaataaacaggactgtggcagcagaggtcagg
aagcagatatctggacagtatggaggttccccacagctcttcaaacacccaaatgcaggg
acagcggcaagtaacacggtgcccctcacggaagcggtggacccagtggattttgaggag
tacctgatcacacaccctcccatcgtggagtcgggacctctcagagatctaatagagttt
cctcctgatgatatcgaagtcatctacacaccgagggaatgtcgcacagtagtacaggct
gtcccagaagaaggagacacagatgctcatgtcagagactgtgttcgatcatacacagaa
gactgggcgattgttaacaggaaatatcacaagctcggtacgggtttcaatcctaacgca
cttgacaaacaaaaggagcgtcaaaaaggcctccccaagcaaatctttgaagcggatgaa
atgccagagaccagcagttaccaagacgatcaggatgatttgaagcggcgttccatgtct
atagatgacacccccaggggcagttgggcatgcagcatctttgacttaaaaaattcactt
ccggaccctctcctccctcatctcctggaccgcgcacccaatgaggaaatcgaccgccac
aacgaagaccaacgcaaaaccagccgccatcgcgagttgtttgctctacatcctgctctg
gatgaggaagagcccattgagcgccattgtgttcctgaagtacctaaagagcacttcgga
cagaggctactcgtcaagtgcttgtccttgaagtttgaaatcgaaattgagccgatattt
gctagtttggccttatacgatgtcaaggaaaagaaaaagatatcagagaactttttcttt
gacttaaactctgagcaaacaaaagccatgctgcgtccccatattcaaactgcagccatc
tcaacactggcccgatctgctgtattttcaattacctacccttctcaagatgtcttccta
gtcatcaagctggagaaagttctgcaacaaggtgatattggagaatgtgctgaaccctac
atggttttcaaagagtcagatgctgccaagaataaagaaaaattggagaagcttcgcagc
cagtcagagcagttctgccaacgcctgggccgctaccggatgccatttgcttggactgca
atccacctgatgaacatcgtcaacagtgcaggcagcttggagagagacacagaaatggag
atgagtctgtcagagcgaaaaggctcttggtctgagcggaggaactcaagcatcatggga
aggcgttcactggagaggaccacaagtggagatgaggcttgtagcctcacagggttcaga
ccggccactctcaccatcaccaattttttcaaacaggaaggagacagacttagtgatgag
gatctgtataagttccttgctgatatgaggaggccttcttcagtgctgaggaggcttcga
cccatcacagcccagttgaagttggacatttctccagcaccagagaacccccactattgc
ttgacccctgacctcctgcaggtcaagccttaccccgacagcagagtccggcccacacgc
gaaatccttgagtttcctgcgagggatgtctacgtgccaaataccacatacaggaatcta
ctgtatgtcaaccctcaaagtcttaactttgccaaccgccaaggctctgcccgcaacatc
actgtcaaagtgcaattcatgaacggagaagacccaaataatgccatgcctgtcatattt
ggaaagtccagctgtgcagatttctacaaagaagcctatacttctgtagtataccataac
agatcgccagacttttcggacgaggtcaaaattaagctccctgcatctttgtccgatcac
caccacatcctcttcaccttttatcatgtcagctgtcagcagaagcaaaacacaccactg
gagacgcctgttggttacacgtggatccccatgttgcagaatgggcgtctgcggacggga
cacttttgccttcctgtgtctctagaaaaacctcctcagtcctactcagtgctctctcca
gatgttccacttccaggaatgaagtgggtggataaccatcgaggtgtatttaatgtggaa
gttacagctgtctccaccattcacacgcaggatcagtacctggataagttctttgctctg
gtgcacgccttggatgagcacatgttcccagtgcggattggagacatgcgtattatggag
aacagtctggaggcagagctcaaaaccagcatcgcagccctgaactctgctcaactggag
cctgttgtgaggttccttcacctgctgctggataaactggtgctgcttgtggtgcgccca
ccagttattgctggacagatagtgaacctgggacaagcgtcattcgaggtcatggcgtct
atagtaaaccgactccataaatatctggacaccagccaagacatgcatggacgcaacagt
ctgctatcctcctatatccactatgtcttccgtctgcccagcactgaccccaactcccct
tcaccggactccgattcagcttcaacaggccctggtggactgggaggttccatgcactat
gccaccatggctcgatcagctgtgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcccgtagccttagcaacagtaatcctgac
atttccgggacgcccacctcccctgatgacgaggttcgctccatcatcggcagcaagggt
ttagaccgctccaactcctgggttcactccatgggctgtaacagtgacccgtggggatcc
agccctgggtctgctccagaaaccatgcaggccatggagcgctgtggtaatcgcatgtct
tcgcacactgagagctccagtttcttgcaaagtttaacaggacgattgcccacaaaaaag
ctgtttcacgaggagttggctctgcagtgggttgtgagcagtggcagtgtccgtgagggc
gctctccaacaggcctggttcttctttgaactgatggtgaagagtattatccaccacctg
tacttcacggaccggttggagtcgccacggaaacatcgcttcccagagcgcttcatggat
gatatcacagccctggtcagcaccatcgccggggatattgtatctcgctttcagaaggac
ttggagcttgtggagagacttaacaccagcctggccttctttctgaatgatttgctctca
gtaatggacaggggctttgtcttcactttaataagagcctattggaagcaggtgtcaacg
aagctttataatctccaaaaccccaccctggagtctctaaggctggatttcttgaggatt
gtgtgtagccatgagcattatgtcacacttaatctcccgtgcagcctgctcaccccccca
gcctccccatcgccttctgtgtcatctgccacttcacagagctctggtttctccactcat
gtccaagaccaaaaaatagccaacatgtttgagctgtcagttccatttcgagagcagcac
tttttggctgggctggtgttgtctgagctgtctgtgattctagagccagagaatgaagtg
atgtttggtctgcataagaaagtggtaaatgtagttcataacctgctctccagtcatgac
tctgacccacggtatgccgacccagaggtcaaaggtcgagttgccatgctgtacctgcct
ctaattgggatcgtcatggaagcactgcctcagctgcacgacttcactgaatcccataac
cagtgggggcgtcctggagctcccccgggggcagcagtgagcagcagtggtgaagaggca
gaaagtgaagctaacataattaaccaaactgttgccatggcaatagcaggcacctccaca
gcgtcgccaatgtcccgaccgagcagcttcatgctcaactcccagaccccacgtcagcat
gggagcttttcggctgagtccagtcgcagtctgttgatctgtctcctgtgggtgctcaaa
aatgcagatgagctggtgctacagaagtggttcactgacctgtctgtgacccagctcaac
cgccttctggacctactttacctctgcgtatcctgctttgaatacaaggcccatgttgtg
ttcacaatgcaggggaagaaggcctttgagcgaatgaacagcctcacattcaagaaatcc
aaagacatgaaggctaaactggaggaggctattttgggaagcatcggggccaggcaggag
atggtccgtcgcagccgtggtcagctagagcggagtccttctggcagtgcttttggcagc
caggaaaacttgcgctggagaaaggacatgacccactggagacagaacagtgaaaagttg
gacaagagtcacagatcagtcaggacaagagcagagctggagcatgaagcacttatagat
ggaaacctggcaacagaggccaacctaattattctggatacattggaaatcattgtacag
actgtatccgtgactgaatccaaagagagcatcctgggaggagttctgaaggtgctgcta
cacagtatggcctgtaaccagagcgccctctacctgcagcactgctttgctacacaaaga
gcacttgtgtctaagtttccggagctgctgtttgaagaggagacagagcagtgtgcagat
ctttgtttacggttgctaagaagctgcagcagtagcatcagcaccatcagatctcatgcc
agcgcttctctctacctcctcatgagacaaaactttgagataggaaataactttgctcgg
gtgaagatgcaggtgaccatgtccctctcatctcttgtgggaacatctcaaaatttcaat
gaggagtttttacgccgttccttaaaaacaatcctcacgtatgcagaggaggacctggag
ctcagagaaaccacatttccagaccaggttcaggaccttgtatttaatttgcacatgatc
ctgtcagacacagtgaagatgaaagagcatcaggaagatccagagatgctcattgatctg
atgtacagaatcgctaagggttaccaaacgtctccggacctgcggctcacgtggctccag
aacatggctgggaaacactcagagaggaacaaccacgcagaggctgcccagtgtttggta
cacagcgccgccctggtggctgaatacctcagcatgttggaagatcgcaaatatctccct
gtgggttgtgtcacgttccagaacatctcttcaaacgtgctggaggagtctgcagtctct
gatgatgtggtgtctccagatgaggagggcatttgttctggaaaatacttcacagaaatc
ggtttagtcggacttttagagcaggctgctgcctctttttccatggcaggcatgtacgag
gcggtaaatgaagtttataaggtactcatcccaatccacgaagctaaccgcgatgcaaag
aagctagccactattcatggtaaactgcaggaagcatttgggaaaattgttcatcagagt
actggctgggaggacggaaagcgcatgtttggtacttacttcagagttggattttatggc
tcaaaattcggtgacttggatgagcaggagtttgtttacaaagagccagctatcaccaaa
ctggcagaaatctcacacaggctagagggtttctatggggagagatttggagaagaccag
gtagaagtcattaaagactccaacccagtggacaaatgtaaactggacccaaataaggcc
ttcatccagatcacgtatgtggagccgtattttgacacgtacgaaatgaaggaccgcatc
acgtacttcgataaaaactacaacctgcgacgcttcgtgtactgcacccccttcactctg
gatgggcgagctcacggagacctgcacgaacaatacaaacgcaaaaccatcctgaccacc
tcccacgccttcccctacatcaagactcgaatcaacatcatccacaaagaggagataatc
tctactcccatcgaagtagccattgaggacatgcagaagaagacgcaggagctggccttt
gccactcaccaggaccctgctgacgccaagatgcttcagatggtcctgcagggatcagtg
ggcacgacagtcaaccagggtcctttggaagtagctcaagttttcctgtcagagattccc
agtgatcctaaactatacagacaccataacaaactacggctctgcttcaaagatttcact
aagaggtgtgaggatgctctgcgcaagaacaagagcctgattgggccagatcagaaagag
taccagagggaactggagcggaactaccatcgcctgaaggaggcgctgcagcctctcatc
aacaggaagatcccacagctttacaaacctgtcttgcaggtcaacgcacacagagattcc
ttcagccgattgagtcttcgtaaactcgacatctga

DBGET integrated database retrieval system