KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160543Help
Entry
110160543         CDS       T05002                                 

Definition
(RefSeq) gamma-glutamyltransferase 5-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00430  Taurine and hypotaurine metabolism
bpec00480  Glutathione metabolism
bpec00590  Arachidonic acid metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110160543
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    110160543
   00480 Glutathione metabolism
    110160543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpec01002]
    110160543
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bpec04090]
    110160543
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     110160543
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     110160543
    3.4.19.14  leukotriene-C4 hydrolase
     110160543
Peptidases and inhibitors [BR:bpec01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   110160543
CD molecules [BR:bpec04090]
 Proteins
  110160543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 110160543
NCBI-ProteinID: XP_020780861
Position
Unknown
AA seq 560 aa AA seqDB search
MAQLRPWLVRCCVFAGVLCVVTVVCVCVLASFDKGCASGSYRLAAVSADSRRCSEIGKKI
LQQGGSAVDGAIAALLCTSLVNPQSMGIGGGSIVTIRDTSGKVKVYNFRETVPQSYKRNL
LEDCPKTFSLSSGSQWIGVPGELRGYETLHEQYGRLPWNKLFEPSVKLAREGIPLPDYLA
NFLNTSLVRYLVESTSLCDIFCNKNRTVLKKGDTLKYTKLAETMETVGKSGAEAFYSGKI
GSALIEDVSATGGTLTLEDLKGFKVRVDHALQVPLGDTVMHIPPPPAGGPLLAFILQLMR
EFVPNPKSLDADQKIQMYHRYVEAAKFANGQKKAIRDPPFNKAKSAAHLTDPSFIAHIKD
LISNQTHDNSIYSSVTPPPDNFGTTHVSVLDENGLAVSATSTINQVFGGAVYSPQTGIIL
NNELADFCHRADVIKPGEQPPSSMTPVILETKSGGLLVIGGSGGSMITSAVALSIMNRLW
LKMSLKDAIAAPIVFVDSKNNVNFEPGFDESVIEGLRSLGHKVGNWPFFLNVVNAVERER
EGGCISAFSDSRKFGETAGY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattgaggccatggctggtgcgctgctgtgtcttcgctggggtgctgtgcgtg
gtgacggtggtttgtgtgtgcgtcctcgcgtcctttgataagggatgtgccagcggcagc
tacaggctcgcggcagtgtctgcggactcgcggcgctgctctgagatcggcaagaagata
ctgcaacaaggcggatcggcagtagatggcgctattgcagctcttctctgtacctctttg
gtcaacccgcagagtatggggataggaggaggctctatcgtcacaatcagagacacatct
gggaaggtcaaagtttacaacttccgagagactgttccacagtcttacaaaagaaacctg
ttggaggactgccccaaaacattcagcttgtcttcaggcagccagtggattggtgtgcct
ggagaactgaggggctatgagacgctccacgaacagtatgggagactgccctggaacaag
ctgtttgagccctctgtgaaattggcccgagaggggatacccctgcctgattacttggca
aacttccttaatacatccctggttaggtacttagtggagagtacatctctgtgtgacatt
ttttgcaacaaaaacaggacagttttgaaaaaaggagatactcttaagtacactaaactt
gctgaaaccatggaaacggttggtaagtctggggcagaggccttttacagtggcaagatt
ggaagcgcccttattgaagatgtcagtgctacaggaggaactttgaccctagaagatttg
aaagggttcaaggtcagagtggaccatgctctccaagttcctttgggggatactgtgatg
cacatacctcctcctccagcagggggccctctgctcgcctttatactccagctcatgaga
gaatttgtaccaaacccaaagtccctggatgcagaccaaaagattcagatgtaccatcgt
tatgtagaagcagctaaatttgccaatggacagaaaaaggctatccgtgatccaccgttt
aataaggcgaagagtgcagctcacctaactgacccctccttcatcgcccacatcaaagat
ctcatctctaaccagactcacgacaactccatctactccagtgtcacacccccgccagac
aactttgggaccacccatgtctctgtgctggatgagaacggtctagcagtgtctgccacc
agcaccatcaaccaagtgtttgggggggctgtttattctccacaaactggtatcatcctc
aacaatgaactggctgatttctgtcacagagctgatgtaataaagccaggtgagcagcct
ccctcgtcaatgactccagtcatccttgagaccaagtctggagggctgcttgtgattggt
ggatctggaggaagtatgataacctctgcagtggcattgtctataatgaaccgcttgtgg
ctgaaaatgagcctgaaggatgctatcgctgctcccatagtgtttgtggattcaaagaac
aatgtcaactttgagcctgggtttgatgagtctgttattgaaggccttcgctcactcgga
cacaaagtggggaattggccattcttcctcaatgtggtcaatgctgtggagagagagaga
gagggcggctgcatctctgccttctcagacagtcggaagtttggagagacagcgggatac
tga

DBGET integrated database retrieval system