KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160769Help
Entry
110160769         CDS       T05002                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00340  Histidine metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    110160769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110160769
Enzymes [BR:bpec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     110160769
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110160769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 110160769
NCBI-ProteinID: XP_020781109
Position
Unknown
AA seq 296 aa AA seqDB search
MASPFKSLVHDDECYDKSYAVYRMHTDAQQYREDFIRKILPDHLASIGDGKSIKIIGLGT
GEGDYDIEMLSHMRLKHPGVLLDNEVVEPSALRIHKYKERAAQMSHLDPVNFTWHQMTAS
EFEEQWRQRNITKKVDFIHMLHMLYYVEDLGATLRFYQSLLKKNGKMLIILLSAESGWVK
MWRTFYTQLSPPGTRTWFPQRNTAEIKQLLDEAGVPYQSYKVPSMLDITDCFTEGHETGE
LILNFITETVNFRKTAPHELREGVLRMLRDPQCSMEKNGRILFNKWEEFIIVEATD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcctttcaagtccctcgttcatgatgatgaatgttatgacaagtcctacgct
gtgtacaggatgcatacagatgcacaacagtacagagaagacttcattcgcaagattcta
cctgaccatctggccagcattggggatgggaaatcgataaagatcattggacttgggact
ggagaaggtgattatgacatagagatgctctcccatatgcgtctgaagcacccaggggtg
ctgctggataacgaggtggtggagccaagtgcacttcggattcacaaatataaagagagg
gcggctcagatgtcccacttggacccagtcaacttcacctggcaccagatgacggcctcc
gagtttgaggagcagtggagacagagaaatatcaccaagaaggtcgacttcatccacatg
ctccatatgctgtactatgttgaggatcttggagcgaccctcagattctatcagagcctc
ctgaagaagaacggcaaaatgctgataattttattgtcagctgagtctggctgggtgaag
atgtggagaaccttctacactcagctgagccccccagggactcgtacttggtttccacaa
cggaacacagcagaaataaagcagctgctagatgaagctggagtcccgtaccagagttat
aaggtgccgtctatgctggacatcaccgactgtttcactgaaggacatgagactggagag
ctgattctaaacttcatcacagagacagtgaactttagaaagacagccccacatgagctc
agagagggggtactgaggatgctgcgagaccctcagtgcagtatggagaaaaacggaaga
attctgtttaataaatgggaggagttcattatcgtggaagcaaccgattaa

DBGET integrated database retrieval system