KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160784Help
Entry
110160784         CDS       T05002                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04020  Calcium signaling pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110160784
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110160784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bpec04030]
    110160784
G protein-coupled receptors [BR:bpec04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110160784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 110160784
NCBI-ProteinID: XP_020781121
Position
Unknown
AA seq 349 aa AA seqDB search
MPKQSDSMPKRLALICFLSLVMLMSILGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLL
VSVLVMPFGAIELVHEHWIYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLV
YRNKMTPMRVALMIGGCWSIPTFISFLPIMQGWNSIGIDHLIEERRHSEGSNSTSCVFMV
NKPYALTCSVVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRAGGASLAVDSADHQRNH
RMRTETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIGYTVPEQLWAACLWLGYINSMLNP
ILYAFLNKSFRRAFLIILCCGRKRYRRPSILGTPQCTTTQINGSTHVLK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcaaagcgacagcatgcccaagcggctggctctgatctgcttcctgtctctg
gtcatgctcatgagcattctgggaaacctgctggtcatggtggccgtgtgcaaagaccgc
caactcaggaaaatcaagaccaactacttcatcgtgtcgctggcgttcgcagacctgctc
gtgtccgtcctggtgatgccgttcggggccatagagctggtccacgagcactggatctac
ggagagaccttctgtttggtcaggacctctctggacgtgctcctcaccaccgcctccatc
ctgcacctctgctgcatcgccctcgacaggtactatgcgatctgctgccagccgctggtc
tacaggaacaagatgactccgatgcgagtggctctgatgatcgggggctgctggtccatc
cccaccttcatctccttcctgcccatcatgcagggctggaacagcatcggcatcgaccac
ctgatcgaggagcgcagacacagcgagggctccaactccacctcctgcgtcttcatggtg
aacaaaccttacgctctgacctgctctgtggtggccttctacatccccctggtcctcatg
gtcctggcctatcagaggatctacgtcaccgccagggcccacgcgctccagatctccatg
ctccagagagccgggggagccagcctcgccgtggactccgccgaccaccaacgaaaccac
cgaatgaggactgagacgaaagccgctaagactctgtgcatcattatgggctgtttctgt
ttatgctgggcaccatttttcgtgacaaacgtggtggaccccttcatcgggtatacagtc
ccggagcagctgtgggcggcctgtctctggttggggtatataaactccatgttgaacccc
attctctacgccttcctgaataagtcttttcgccgtgcgttcctcatcatcctgtgctgc
gggaggaagaggtacagaaggccgtccattttggggaccccgcagtgcacgacgacgcag
atcaacggctccacgcacgtgctcaagtaa

DBGET integrated database retrieval system