KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162037Help
Entry
110162037         CDS       T05002                                 

Gene name
tmem150c
Definition
(RefSeq) transmembrane protein 150C
  KO
K21846  transmembrane protein 150
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpec04131]
    110162037 (tmem150c)
Membrane trafficking [BR:bpec04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    110162037 (tmem150c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frag1
Motif
Other DBs
NCBI-GeneID: 110162037
NCBI-ProteinID: XP_020782560
Position
Unknown
AA seq 254 aa AA seqDB search
MNEMDRPMDRLKRHSPWALLPPLFSTCVAAGLFMVYFVAVSHGQVVPLTSQYQPNKSVLP
PYISIVGNSPPASCIFSQVMNLGAFAGFIIAVFRYLQIKNTLYKPWLNIICVFAFSVACF
GMTLIGNFQLFVEEEIHNFGTILTFGLGTLFCWIQSYITLKVNLKKEGFRTSLLRFLLST
GITICFVLYSTLMAQELHMHAARGQWSLVILFLTFIGTFCVEFRHYRLDFQVTDISREPV
SMTFTEMSTHYADT
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatggacagacctatggacagactaaagaggcacagcccatgggccctccta
cctcctctgttctccacctgtgtcgctgctggcctttttatggtatattttgtggctgtt
tcccatggtcaagttgtacccctcacctcacagtatcagccaaataaaagtgtccttcct
ccttacataagcattgtaggaaattccccaccggccagctgcattttcagtcaggtcatg
aacctgggagcttttgcagggtttattattgctgtcttccgatacctccagatcaagaac
acattgtataagccatggctgaacattatttgtgtctttgctttttctgttgcctgcttt
gggatgacactcatcggaaatttccaattatttgttgaggaagaaatccataactttggc
accattctgacatttggcctgggcactctcttctgttggattcagtcgtacatcactctg
aaggtgaacctcaagaaagaaggattcagaacaagtcttctccgcttccttctgtcgacg
ggcatcaccatctgcttcgtactgtactccactttaatggcacaagagctccacatgcac
gcggcccgaggacagtggtctctcgttatcctcttcctaaccttcatcgggacgttttgt
gttgaatttcgtcactaccgcttggacttccaggtcacagacatcagtagagagcctgtc
agtatgaccttcactgaaatgtccacacactatgcagatacatag

DBGET integrated database retrieval system