KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162426Help
Entry
110162426         CDS       T05002                                 

Gene name
gria1
Definition
(RefSeq) glutamate receptor 1
  KO
K05197  glutamate receptor 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110162426 (gria1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bpec04040]
    110162426 (gria1)
Ion channels [BR:bpec04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   110162426 (gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Motif
Other DBs
NCBI-GeneID: 110162426
NCBI-ProteinID: XP_020782981
Position
Unknown
AA seq 920 aa AA seqDB search
MLRSFAILFTSFLGMSLGQGSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQV
DMVKMGNSFSMTYAFCSQFSKGVYAIIGLYDRKTVNMLMSFCGALHVCFVTPSFPIETAN
QFVIQLRPELQDALVGVIDHYRWTKFVYMYSSNSGLSVLQKVLDTAAEKNWLVTSVNVET
MTDNSFLKVFQDLDKRKEGQIIIDCETDRLTGILKMIVDKGKNAKSYHYILANLGFLDID
LTDLRKGGANITGFQLVNNSEPEVSRVVQQWMEFDIKDSKMPKTGLKYTGALTYDGVKVM
ATAFQNLRKQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIDGLTGHIQFNEKGR
RTNYTVSVMELAPSGPKKVGYWNEDEKYVTTASSIRGINDTYGLQNRTYIVTTILESPYV
MLKKNHEQLVGNDKYEGYIVELAAEIAKHVGYQYKLKIVSDGKYGARDPDSKMWNGMVGE
LVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEDYEEGGEPQTPTQPSASNGVQQTPTVPQPNAV
QQSPEQTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKAADPSV
FVKTTDEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSP
LRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIG
GLGLAMLVALVEFCYKSRTESRRMKQSINDAMRCSTLTRMSGNGNGGENGRILTHDFPKT
VQTLPCMSHTASMGLGASGM
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaagcttcgccatcctcttcaccagttttctggggatgagcttgggtcaaggc
tcaagttttccaagcaacatcaatataggaggattgttccccaccgaatcgcatgaatat
gaggtttttcggttcgccctgtcccatcaccaggacatccccaaactggtgccgcaggtg
gatatggtcaagatgggaaacagcttttcaatgacatacgccttctgctcccagttctcc
aaaggggtgtacgccatcatcggcttgtatgacaggaagaccgtgaatatgctcatgtct
ttctgcggggcccttcacgtctgcttcgtcactccttcgtttcccattgagaccgccaac
cagttcgtgattcagctgaggcccgagttgcaggacgccctggtgggggtcatcgatcat
taccgctggaccaagtttgtctacatgtacagctccaactcaggcctctcggtgctgcag
aaagtcttagacacagcagcggagaagaactggctggtgacgtccgtgaatgtggaaacc
atgaccgacaactctttcctcaaagtgtttcaggatctggacaagaggaaggagggtcag
atcatcatcgactgtgagaccgaccgcctcactgggatactcaagatgattgtggataaa
ggaaaaaatgcaaagagctaccactacatcctggctaacctgggctttctggacattgac
ctgacagacctaagaaaaggcggagcaaacatcaccggcttccagctcgtcaacaactct
gagcccgaggtcagccgcgtggtccagcagtggatggagtttgacatcaaggactcgaaa
atgcccaaaactggactcaagtacactggtgctttgacatacgatggagtgaaggttatg
gcgaccgcatttcaaaacttgaggaagcagaggatagacatttcacgaaggggcaacgct
ggagagtgtctggccaatccacccgctccttggggccaaggcattgacatacaaagggcc
ctacagcaggtccgcatagatggattgactgggcacattcagttcaatgagaaaggacga
agaaccaactacacagtcagcgtcatggagctggcgccgtctggacccaaaaaggtggga
tactggaatgaggatgagaagtacgtcaccacagccagctccattcgaggcatcaatgac
acttacggactgcagaaccggacctacattgtcacgacaatcctggagtctccatatgtg
atgctgaagaagaaccatgagcagctggtggggaatgacaaatatgagggctacattgtg
gagctggcagcagagatcgccaaacacgtggggtaccagtacaaactcaagatcgtctct
gatgggaaatatggggcccgagatccagattccaaaatgtggaacggtatggtgggagaa
ctggtctatgggaaagcggatgtggctgtagctcctctcaccatcactcttgtacgcgag
gaggtcatcgacttttccaaacccttcatgtctttgggcatttccatcatgatcaagaaa
cccaccaagtccaaaccaggggtcttctccttcctggaccccctggcatatgagatctgg
atgtgcatagtctttgcatacattggggtcagcgtggttctcttcctcgtcagtcgcttc
agtccgtacgagtggcattcagaggactacgaggaggggggtgagccacagacccccacc
cagccctctgcgtccaatggggtacaacagacgcccacggtcccacagcccaatgctgtt
cagcagagtccagagcagaccaatgagtttgggatctttaactcactctggttctcactg
ggagccttcatgcagcaaggatgtgacatctcgccaaggtctctgtcggggcggattgtg
ggaggcgtgtggtggttcttcacccttataatcatctcgtcctatactgccaacttggct
gccttcctcactgtagagaggatggtgtctcctatagagagcgctgaggatttggccaag
cagacggagatcgcctatgggactctggacgcaggatccaccaaagagttttttaggagg
tccaagatcgcagtatttgagaaaatgtggtcatacatgaaagcagcggacccctcagtg
tttgtgaagaccaccgatgagggtgtgatgagggtccggaagtccaaagggaaatacgcc
tacctcctggagtccaccatgaacgagtacatcgagcagaggaagccctgtgacaccatg
aaggtcggtgggaacctggactctaaaggttacggcatcgccactccaaagggctccccc
ctcagaaaccccgtaaacctggcagtcttaaaactgaacgagcagggcctcttggacaaa
ttgaaaaacaagtggtggtacgacaagggagagtgcggcagcgggggcggggactccaag
gacaagacgagcgctctgagcctcagtaacgtggctggcgtgttctacatcctgattggt
ggtttgggtttggccatgctggtggctctggtggagttctgctacaagtctcggaccgaa
tcacgccgaatgaagcaatccataaacgacgccatgcgctgctccacactgaccaggatg
agcgggaatgggaacgggggcgagaacggacgaatcctcacccacgacttccccaaaacg
gtccagaccctgccctgtatgagccacactgccagcatgggactaggtgcgtctggaatg
tga

DBGET integrated database retrieval system