KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163147Help
Entry
110163147         CDS       T05002                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04260  Cardiac muscle contraction
bpec04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110163147
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110163147
   04261 Adrenergic signaling in cardiomyocytes
    110163147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bpec04040]
    110163147
Ion channels [BR:bpec04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110163147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 SUR7 L_HMGIC_fpl DUF202
Motif
Other DBs
NCBI-GeneID: 110163147
NCBI-ProteinID: XP_020783741
Position
Unknown
AA seq 348 aa AA seqDB search
MSSCSSRALTILSTVFGACGLLLVGVAVSTDYWLIMVEGIILQQNQSMEVKMALHSGLWR
VCFVAGSENGRCVASEYFTEPDIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFNYHYGWSFA
FAASSFLLKEGAGVLSVYLFMKRYAEEEMYRPHPALYRPRMSESSDYSGQYLHPETTWPP
PHPKRGRSTSEGSSDISIQLNQTPPSAGKANLQQSRGGQGSAATGSPPSASSSAGSYNMP
AQSGGYTGTHTLPRGSHAQGQALPLAVPPSPVPPPHYHAHIHMGASPC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtgcagtagccgtgccctcaccatcctgtccacggtgttcggggcgtgcggg
ctgctgctggtgggcgtggccgtctccaccgactactggctcatcatggtggagggcatc
atcctgcagcagaaccagagcatggaggtgaagatggcgctgcactcgggcctgtggagg
gtctgctttgtggccggatcagaaaacggacggtgtgtagcgtctgaatatttcaccgaa
ccagacattgaaatcaccacagaaaacactgcaaatattctcaaaatggtgcgcacagcc
actcctttccccatggtgtctctgctcttcgtcttcactgcctttgtcatcagtaacatc
ggacacatccggccacagcgcaccatcctggccttcgtctccggcatcttcttcatcctc
tcaggcctgagtctggtggtgggtctggtcctgtacatctccagtataaacgatgaggtg
atgaatcgaccccgggagccagagcagttcttcaactaccactatggctggtctttcgcc
ttcgccgcgtcctccttcctgctcaaggagggggctggggttctgtccgtctacctcttc
atgaagcgctacgcagaggaggagatgtaccgcccccacccagccctctaccgcccccgc
atgtccgagagcagcgactacagcggccagtacctgcacccggagaccacctggccccct
ccccacccaaagagaggcaggagcacgtcggaagggtccagtgacatctccatccagctc
aaccagacccccccatctgcgggcaaagccaacctgcaacagtccagaggggggcagggg
tcagcagccacggggagtccaccctctgcgtcgtcttcggctgggagttataacatgccc
gctcagtctggaggctacacgggcacgcacacactgcccaggggctctcacgcccaaggc
caggctctacccctggccgtgcccccctctccggtaccacccccgcactaccacgcacac
atccacatgggagcttcaccgtgctaa

DBGET integrated database retrieval system