KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110164417Help
Entry
110164417         CDS       T05002                                 

Definition
(RefSeq) adenosine kinase-like
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00230  Purine metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110164417
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     110164417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 110164417
NCBI-ProteinID: XP_020785107
Position
Unknown
AA seq 236 aa AA seqDB search
MNSPALLFRGKESPGQTFVGAIIGYVRESPPLRTSLGAEPPALSVVQFSPFCSCEKLLQG
FFLTVSPDSILKVAKHASENNKIFGLNLSAPFISQFFKEPLMKVMPYVDILFGNETEAAT
FASVLGFGTEDIGEIAKKAQNLPKENAKRQRIVVFTQGKDDTVATVGDKAINFPVLDIDQ
NDIVDTNGAGDAFVGGFLSAQVQEQSLEECIRAGHYAANVIIRRVGCTFPEKPNYQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccagctctcttgtttcgcggtaaggagagtccgggccagacttttgttggg
gccatcatcggatacgtgcgcgagtctccccccctccgaacgagtcttggagccgagcca
ccagctttgtccgtggtccagttttcccctttttgtagctgtgagaaactgttacagggc
ttcttcctgaccgtctctcctgactccatcctcaaagtggccaaacacgcctccgagaac
aacaagatctttggtctgaacctgtccgctccgttcatcagtcagttcttcaaggagcct
ctcatgaaggtgatgccctacgtggacatcctgtttggaaacgagacggaagctgctact
ttcgctagtgtcctggggtttgggacggaggatatcggcgaaattgccaaaaaggcccag
aatttgccaaaggagaacgcaaagagacagcggatagtggtgttcacgcaaggaaaggat
gacaccgtcgccactgtgggagacaaagccatcaatttcccagttctggacatcgaccaa
aacgacatcgtggacacaaacggagctggagatgctttcgttggaggattcctgtctgca
caggttcaggagcagtctctggaggaatgcattcgcgctgggcactacgcagccaacgtc
atcatcagaagagtcggctgcaccttccctgaaaaacccaactaccaatga

DBGET integrated database retrieval system