KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110165111
Entry
110165111         CDS       T05002                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00100  Steroid biosynthesis
bpec01100  Metabolic pathways
Module
bpec_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110165111 (tm7sf2)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110165111 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 110165111
NCBI-ProteinID: XP_020785933
Position
Unknown
AA seq 420 aa
MTQGAKRTHTTEREFGGTLGAICIPIFLPLTVLFLIGVSRTPSASPFQWPPPFPSSDLLW
HPLAPVLLLGWIGLHALLYLLPLGKMSEGLELKNKTRLKYPINGFHAMCISVGLILLLLK
LGAPLGRLFELLPPLAVCAIVLSFLFSVFLYARSFSVPSDALAPGGNTGNHLYDFFIGRE
LNPRIQDFDLKYFCELRPGLIGWVVINLGFLMKEAELQGSPSLAMILVNGFQLLYVGDAL
WNEEAVLSTMDIVHDGFGFMLVFGDLVWVPFTYSLQAAFLVVHPQSLSWFGAAVIIALNG
IGYYIFRSSNSQKNQFRRDPNHPNVSKLKTIPTASGKKLLVSGWWGFVRHPNYLGDLLMA
LAWSLPCGFSNLLPYFYVIYFTVLLIHREARDERQCKLKYGASWDSYCKQVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgacacaaggagccaaacgcacgcacactactgagagagaatttggagggactcttggt
gctatttgtatccctatcttcctcccattgacggtgctgtttcttatcggtgtgagtcgg
acaccttcagccagtcctttccagtggcctcctcccttcccttcctctgacctgctctgg
caccctctggcccctgtgctgctgctgggatggataggcctgcatgcactcctctacctg
ctgcctctggggaagatgtcagaaggactagagctgaagaataagacacgcctcaagtat
cctataaatggtttccacgccatgtgcatcagtgtggggctgattctgctgttgctaaag
ctcggtgctcctctgggtcgcctctttgagttgctgccccctctggccgtgtgtgctatt
gtgctgtcattcttgttctccgtcttcctctacgcacgttccttttcagtcccctctgat
gctctggctccaggaggtaacacaggaaatcacttgtacgatttcttcattgggcgggaa
ctaaaccctcggattcaagattttgacctaaaatatttttgcgagctgagaccaggtctt
attggatgggtggtgattaatttgggtttcctaatgaaagaggcggagctccaaggttcc
ccatccctcgccatgatccttgtcaatggtttccagctgttgtatgtcggagatgctttg
tggaatgaggaggcggttctctcgactatggacattgttcacgatggtttcgggttcatg
ctggtgtttggagacctggtttgggtgccctttacttatagcttacaggccgcttttcta
gttgtccacccacagtcactcagttggtttggagcagctgttataatagcacttaatggg
attgggtattatatctttaggagctcaaattcacagaaaaaccagttcagaagagatcca
aaccatcccaatgtttcaaagctgaaaaccatcccgacagcatcagggaagaaactgctg
gtgtccggatggtggggttttgttcgtcatcccaattacctcggagacctgctcatggcg
ctggcctggtccctgccatgtgggttttcaaatctcctgccatacttctacgtcatatac
ttcaccgtcctattgatccacagagaggcgcgtgatgagagacagtgtaagctcaaatat
ggggcatcctgggactcctactgcaaacaggtcccctacagaatattcccatatatttac
tag

DBGET integrated database retrieval system