KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110165237Help
Entry
110165237         CDS       T05002                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110165237
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110165237
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110165237
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: STE group
  STE20 family
   110165237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH
Motif
Other DBs
NCBI-GeneID: 110165237
NCBI-ProteinID: XP_020786067
Position
Unknown
AA seq 607 aa AA seqDB search
MALSLSPLSPFTPRSPSDDVFWDPPETPPKVPERTTSKFYCKELIKRHNRTPSSGSPVSL
VDHSGRPHGSPSLNNNHPGYFLLESPLLQHRPQNLRPSHHTQGLKSPQSRLNKATEYSSS
SDEICSSDEDERSRPGLSNGKGKYLKGVPNGLKLQLPHNLNQLSPPLSHKMPRVTSDDPT
YMLPDLLQKTSSSPTHIAPGQRGMSYCQSPTATRSPTHRDQGEIQSAGSSSSFLSFIDPR
LLHISTPPHSPTGVKGEGVRREGHRKGSIVNVNPTNTKPQSDTPEIRKYKKKFNTEILCA
GLWGVNLLVGTESGLWLLDRSGQGKVYSLISRRRFQQMDVLEGLNVLITISGKKNKLRLY
YLSWLRNKILHNDPEVEKRQGWSSVGDLEGCGHYKVVRYEKIKFLVIALKNAVEVYAWAP
KPYHKFMAFKSFRSLPHRPLSVDLTVEEGQRLKVIYGSVSGFHAVDVDSGAVYDIYLPTH
IPGSIRPHAIVLLPQTAGTELLVCYEDEGVYIDTFGRITKDTVLQWGEMPASVAYLQSNQ
VMGWGEKAIELRSANTGSLEGVFMHKKAQKLKFLCERNDKVFFASVQSGGSSQIYFMTLG
HNSLFNW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggccctatctctctcccccctgtctccattcactcctcgctcgccctctgacgacgtg
ttctgggacccccccgagaccccgcccaaggtcccagagagaactacctcaaagttttac
tgcaaagaactgatcaagagacacaaccggacgccatccagcggcagccccgtgtcactg
gtcgaccacagcggcaggcctcatgggagtccttcactgaacaacaatcacccaggatac
ttccttctggagagtcctctgttacagcacagacctcagaacctcaggccgtcacaccac
acacagggattaaagtcgccccagagtcgcctgaacaaagccacagaatactcttcgtcc
agcgatgaaatctgcagcagcgacgaagacgagaggagcagacccggtttgtcgaacgga
aaagggaagtatctgaaaggcgtccccaatggcctcaaactgcagctgccacacaacctg
aaccagctctcccctccgctctcccacaaaatgccccgggtgacctcagacgaccccacc
tacatgctccctgacctcctgcagaagacctcgtccagcccgacccacattgccccgggg
cagagaggaatgagctactgtcagtctcccacggcaacacggtccccgacgcaccgcgac
caaggcgagatccagagtgcaggttcttcctcttcgttcctgtccttcatcgaccccaga
cttctccacatctccacccctccgcacagccccacgggcgttaaaggggagggcgtgagg
agagagggacacagaaaaggctccatcgtcaacgtgaacccgacgaataccaaacctcag
agtgacacgccggaaatcaggaaatacaagaagaaattcaacaccgagatcctgtgtgcc
ggattatggggggtgaacctgctggtggggacagagagcggcctgtggctcttggacagg
agcggacaggggaaagtctactctctgatcagcagaagaaggtttcagcagatggacgtt
ctggagggactcaacgtgctcatcaccatctcaggtaaaaagaacaagctgcgtctgtat
tacctgtcctggctgaggaataagatcctccataacgaccccgaggtggagaagagacag
ggctggagctctgtgggggatctggagggctgcggccactacaaagtcgtccgatacgag
aagatcaagttcctggtgatcgcgctgaagaacgcggtggaggtttatgcctgggcccca
aaaccgtaccacaagttcatggcctttaagtcgttccggtctcttcctcacaggcctctg
tccgtggacctgacggtggaggagggtcagaggttaaaggtcatctacggctccgtgtcg
gggtttcacgccgtcgacgtcgactcgggcgccgtgtacgacatctacctgcccacacac
atcccgggcagtatccgtcctcacgccatcgtgctgctccctcagaccgcgggcacagag
ctgctggtctgttatgaagatgaaggagtttacatcgacacttttgggagaatcaccaaa
gacacggttctgcagtggggagagatgccagcctctgtggcgtacctgcagagtaaccag
gtgatgggctggggggagaaggccatcgagctgcgttctgccaacactgggagtctggag
ggagtcttcatgcacaaaaaggcccagaaactcaagttcctctgtgagagaaacgacaag
gttttctttgcgtcggtccagtctggaggcagcagtcagatctacttcatgaccctggga
cacaactctctcttcaactggtga

DBGET integrated database retrieval system