KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110165429
Entry
110165429         CDS       T05002                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpec03000]
    110165429 (ahrr)
Transcription factors [BR:bpec03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110165429 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 110165429
NCBI-ProteinID: XP_020786277
Position
Unknown
AA seq 666 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKTNPSKRHRDRLNAELDRLANLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQANQDKSSRKHAIHTNHEPRKDSSPMGSIVNESSLLLESL
TGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMCPPA
HQGAQSNQDNPLPTTTGEEYVVSSLFHSPEAGGIPAEMSPFLNRCFIARVRCLLDSTSGF
LTMQFQGRLKFLHGQKKKSGSGALLPPQLALFCIAVPLLLPSITEMKMKNMLLRGKTKGG
GFSGLEHGERGEHLRRHPYSGGMGDISDPLLLPCPTPGPTQRSHHTPWTPLSKDNLKYRP
DGYYNQEEPLNYCKSSMGHHQKGAWPLRSSGPVRGGVGYIPPNRLKGGHFGKPYRYSPSC
HNNRGGEVFVSKLYGNVQIPSDPDAYCVDLVKSENGYGECYDGHMMPEMPPIKVEHDSDS
ENGCDVYGRPYENYDRRYNNSGIYDHSNLQLKSEADYYDPQYSPCQRTKAGISPPYNHSN
NYQNYAVNNRLAKCNKEMSDSHFSPHRLPYNNDSLCNNQSVNLMDNNAYQSTQDNHKQYM
DYNGKHNNTYEFKGHGLIHSIKREPMDSPPWSENEMTQAMMVGQRNHLPCVMSTGQHKAT
PYVYMP
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgatccctcctggagactgcatgtacgcgggcaggaagcggaggaagcccatccaaaaa
cagaagccttcgtctgccaatgagaagaccaatccttcgaagagacacagggacaggctg
aacgcagagctggaccgcctggccaacctgctccccttccccccggacgtcatctccaaa
ctggacaaactctccgtgctccggctggctgtgtcctacctccgcgtcaagagcttcttc
caagcaaaccaagacaagagctccagaaagcacgcgatccacaccaaccatgaacccagg
aaagacagctcccccatgggctccattgtgaacgagagcagcctcctcctggaatctctc
accgggtttgctttggtggtgagcagtgatggcatggtcttctatgcctcctcaaccatc
gtcgactatctgggatttcatcagactgacgtgatgcaccagaatgttttcgactacatc
cacattgacgacagacaggagttcagacgacagctgcactgggccatgtgtcctccagct
caccagggggcgcagtcaaaccaggacaacccactgccaaccaccactggtgaggagtac
gtggtgagtagcctgttccactctccggaggcggggggcatacctgcagaaatgtccccc
tttctcaacagatgtttcatagctagggtccgatgtcttctggacagcacctctggcttt
ctgaccatgcagttccagggtcgcctgaagttcctccacggacagaagaagaagtcgggg
tccggcgctctcttgcccccccagctggctctgttctgcattgcggtgcctctgctgctg
ccctccatcaccgagatgaagatgaaaaacatgttactgagaggcaagaccaagggaggg
ggcttctctggactggagcatggtgagcgcggggagcacctcagaagacacccatactct
ggtgggatgggtgacatttccgaccccctgctcctcccgtgccccaccccgggacccacc
caacggagccaccacaccccctggacccccctctccaaggacaacctcaaataccgtccc
gatggatactacaaccaggaagagccgctaaactactgcaaatcctctatgggtcatcat
caaaaaggggcgtggcctctgagatcttccggtccagtcagaggaggtgtcggctacatc
cctcccaatcgcttgaagggcggccattttggaaaaccataccgctattctcccagttgc
cataacaatcgaggtggcgaagttttcgtctccaagctctacggtaacgtccaaatcccg
tctgatcccgatgcgtattgcgtggatttagtgaaaagcgaaaacggctacggcgaatgc
tacgatggtcacatgatgccagagatgccgccaatcaaagtcgagcacgattcggattca
gagaacggttgcgacgtctacgggcgaccttacgaaaactacgaccggcgctataacaac
agcgggatctacgaccatagcaatctccagctcaaatccgaagccgactattacgacccc
caatactcgccgtgccagaggacgaaggcggggatcagtccaccgtataaccatagcaac
aactaccaaaactacgccgtgaacaaccgcctggcgaaatgcaacaaggaaatgtccgat
agccatttcagcccccacagacttccctataataatgactctctatgcaacaatcagtct
gttaacctcatggacaacaacgcctaccaatctactcaggacaatcacaagcagtacatg
gactacaacggcaagcacaacaacacctacgagttcaaaggtcacggtttgattcactcg
atcaagcgggagcccatggattctcccccctggtccgaaaatgagatgacccaggccatg
atggtggggcagaggaatcatttgccttgtgtaatgagtacagggcaacacaaagctacc
ccctatgtgtacatgccctaa

DBGET integrated database retrieval system