KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110165479Help
Entry
110165479         CDS       T05002                                 

Gene name
galc
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00600  Sphingolipid metabolism
bpec01100  Metabolic pathways
bpec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110165479 (galc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110165479 (galc)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     110165479 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 110165479
NCBI-ProteinID: XP_020786335
Position
Unknown
AA seq 664 aa AA seqDB search
MKQRARLVLLLMLITFEFNSAVIYVLDDKNGLGRVFDGIGGISGGGATTRLLVNYDEPYR
SQILDYLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMHYEDDENYYRGYEWWLMKEAKK
RNPNITLIGLPWAFPGWVGHGKNWPYDFPDITASYVVKWILGAKQYHDLEIQYIGIWNER
SFDSKYIKLLRYTLDKQGLEHVRIVASDNQWEPIALNVLKDPELSAAVDVIGAHYPGTNT
VLDALKTQKQLWSSEDYSTFNDEVGGGCWARILNQNYVNGLMTATISWNLIASYYDDLPF
GRDGLMTAEEPWSNNYVVEAPIWITAHTTQFTQPGWTYLQTVGHLVQGGSYVALTDRKGN
LTVVIETMTHDHSICIRPPLLPFNVTAQNATFHLKGSFASIKELQVWRSQFNFKSKKPVF
FEKLSPLKTLDGTFSLELQEDEVYTLTTITTGVKGSHPDPPPSAPFPKVYKDDFDSKDPP
LSEAPNFADQTGVFEYYKNLTDPGPHVYTLRQILTQTPITWATDADQTISVIGDYHWQNL
TISCDVFMEKVKTGGVFIAARVDKGGQSIRSARGVFYWVYADGTYKVTSDLAGEFVLAEG
LSGTRAYGWYTLTLKVQGQFAYGLLNGYTLWKNAVVLTPKNGWAAIGTSSYELAQFDNFA
VEAE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagagagcccgtttagttttgctgctaatgttaataacttttgagtttaattct
gctgtaatttacgtccttgatgataaaaacgggctgggacgagtgtttgacgggatcgga
ggaattagcggtggaggggcaaccactcgtttacttgtaaattatgatgagccgtatcgc
agccagattttagactatttgtttaagcccaactttggcgcgtcattgcacatactaaag
gtcgagattggaggagatgcccaaactactgacggaacagagccttcacacatgcactat
gaggacgatgagaactactacagaggatacgagtggtggctcatgaaagaagcaaagaag
agaaaccccaatatcacactcattggtttgccttgggcctttccagggtgggtcggccat
ggtaaaaactggccatacgatttcccagacatcacagcttcgtatgtggttaagtggatc
ctcggagcaaagcagtaccatgacctggaaattcagtatattgggatttggaatgagcgg
agttttgacagcaaatacataaagctgcttcgttacactctggataaacagggtctggag
catgtgcggatcgttgctagtgacaaccagtgggagcccatagccctgaatgtgctaaag
gaccccgaactcagcgcagccgtagatgtgataggggcgcactatccgggcaccaacaca
gtcctggacgctctgaagacacagaagcagctgtggtcttcagaggattacagcactttt
aatgacgaggtgggaggaggctgttgggctcgcatcctcaaccagaactatgtgaatggc
cttatgacggcaaccatttcatggaatctaatcgcgagttactatgacgatctccctttt
ggtcgagatgggctgatgacggccgaggagccctggagcaacaactacgtagtggaggct
ccaatatggatcacagcccacaccacacagttcactcagcctggatggacctacctacag
actgtggggcatttagtacaaggtggaagttatgtagctctcactgatagaaaagggaat
ctcacagttgttatagagacaatgactcatgatcactccatttgtataagacctccactt
cttccttttaacgtcacggcccagaatgcaacttttcatctgaaggggtcatttgcatcc
atcaaggagctacaagtttggcgatcgcagtttaactttaaatccaagaagcccgtcttt
tttgagaagctaagtcccctaaagactttggatggaacgttctctctggagttacaagaa
gacgaagtttacactctaacgactataacaacaggggtgaaaggcagccaccctgatcca
cccccatctgcaccatttcccaaagtttacaaagacgattttgacagcaaagatcctcct
ttgtctgaagctccgaactttgctgaccagactggagtttttgaatactacaaaaacctg
acagaccctggaccccatgtttatactctgagacaaattcttactcagacgccgatcaca
tgggccacagatgcagatcagaccatcagtgtcataggagactatcactggcagaatctg
accatctcatgtgatgtctttatggagaaggtgaagactggtggggtcttcatagcagcc
agagtggacaaaggaggccagtccatccgcagcgccagaggggtcttctactgggtctat
gcagatgggacatacaaagtgaccagtgacctggctggagagtttgtgctggctgaaggg
ctgtctggtacacgcgcgtatggctggtacacattgacactcaaagttcaaggtcagttt
gcatatggattgctgaatggatacaccctgtggaagaatgctgtggtactcactcccaaa
aatggctgggcggccattgggacaagctcctatgaactggctcagtttgataactttgca
gtggaagcagagtaa

DBGET integrated database retrieval system