KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110165581Help
Entry
110165581         CDS       T05002                                 

Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00760  Nicotinate and nicotinamide metabolism
bpec01100  Metabolic pathways
bpec04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    110165581
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110165581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bpec04090]
    110165581
   00536 Glycosaminoglycan binding proteins [BR:bpec00536]
    110165581
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     110165581
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     110165581
CD molecules [BR:bpec04090]
 Proteins
  110165581
Glycosaminoglycan binding proteins [BR:bpec00536]
 Hyaluronan
  Cell surface receptors
   110165581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse Protocadherin Tetraspanin DUF2207 Sigma_reg_N EphA2_TM
Motif
Other DBs
NCBI-GeneID: 110165581
NCBI-ProteinID: XP_020786439
Position
Unknown
AA seq 279 aa AA seqDB search
MEEEGQRPKLRKRRVRPIIRIIFGIIVVILVIVVIVVLALALRRTSEHEAFKAVFTSRCK
AYEGGYDCERTWNAFEQAYVGKDPCMVPPDSYQALMDATPFKPACNRMMFWSKTKNVVHD
FTSKRECFITIEDTFLGSLLDGLTWCGKEGSKDTFTSDCPGWTDCVNNTVRSFWNKASAS
YAEVACGNVSVMLNGSIATPFHPASIFASIEMKNFNPVIMNSLNVVLVTQEKKVSNCSSQ
SLKDLQKVLDKGIAYSCKEVPESQIQECASQSKTCGSCW
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaaggacaaagaccaaagctaaggaagaggagagttcgacctatcattagg
atcatttttgggataattgtggttattttagtgatcgtggttattgtagttttggcgcta
gctctgaggagaacgtccgagcatgaggcatttaaagccgtctttacgtctcgatgcaaa
gcgtacgaaggaggatatgactgtgaacggacatggaatgctttcgaacaagcctacgtt
ggcaaagatccctgcatggtgcctccagactcctaccaagctttaatggacgctactcct
ttcaaacctgcctgcaacaggatgatgttctggagcaaaactaaaaatgtggtccatgat
ttcacctcaaagagagagtgctttatcaccatcgaagacacgtttttgggatcgcttctg
gacgggttgacctggtgcggcaaagagggcagcaaagacaccttcacctctgactgtccg
ggatggacagactgcgtcaataatacggtgcgctctttttggaacaaggcttcagcttca
tatgcagaagtggcctgcggcaatgtctctgttatgctaaacggatctatcgcgactcct
ttccatccagccagtatatttgcgagcattgagatgaagaattttaaccccgtcatcatg
aacagtctcaatgtagttctggtcacgcaggagaaaaaagtatcaaactgttccagccaa
tctttaaaggacttgcagaaggtgttagataagggcattgcttacagctgcaaggaggtg
ccagaatcacaaatacaagaatgtgcctcacagtcaaagacatgtggatcctgttggtga

DBGET integrated database retrieval system