KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166186Help
Entry
110166186         CDS       T05002                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00071  Fatty acid degradation
bpec00410  beta-Alanine metabolism
bpec00592  alpha-Linolenic acid metabolism
bpec00640  Propanoate metabolism
bpec01040  Biosynthesis of unsaturated fatty acids
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
bpec01212  Fatty acid metabolism
bpec03320  PPAR signaling pathway
bpec04146  Peroxisome
Module
bpec_M00087  beta-Oxidation
bpec_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110166186
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110166186
   00592 alpha-Linolenic acid metabolism
    110166186
   01040 Biosynthesis of unsaturated fatty acids
    110166186
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110166186
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110166186
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110166186
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     110166186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Las1
Motif
Other DBs
NCBI-GeneID: 110166186
NCBI-ProteinID: XP_020787062
Position
Unknown
AA seq 658 aa AA seqDB search
MNPEILKERQNASFDVQKLICILDGGPEKTKRKREIVSLVLNDPDFDEVDPNFLSRSERY
DQTVRKSAQMISKLRGIVDPEEIYIYSIELCNQFGTLGPQYVMVLPTLYSQCDQEQSKKW
LPLARSFKVMGTYAQTELGHGTHLRGLETTATYDPATQEFVLNSPTVTSIKWWPGALGKT
SNHAIVLAQLYTHGHCHGLHAFIVQLRHMDTHEPLPGILVGDIGPKFGFCEVDNGFLKLD
NVRIPRENMLMKYAKVEPDGRYVKPPSAKLTYGTMVFVRSLIVGLSAINLAKSCTIAIRY
SAVRHQSEIRSGEPEPQILDYQTQQYKLFPLLATAYAFTFVGQYISQTYHRITGDINHGD
FSELPELHALSAGLKAFTTWATNSGIEVCRMSCGGHGYSCSSAFPDLYVQFTPTCTYEGE
NTVMMLQTARYLVKSYRQAKAGQQLKGIMAYLNDMEQRQVRAHPASARPTVVDINDLSNL
VESYKLRAATLVESAARSIQQELQKRKNQEDAWNNSAIDLVRASDAHCHYVVVKLFTEKL
SEIGDTAIHSVLSTLALLYALHGITKNSGDFLQAGLLTVPQMQQISVRIKELLCLLRPNA
VALVDAFDFNDKNLNSVLGRYDGNVYENLFDWARRSPLNATEVHESFHKYLKPLRSML
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggaaattcttaaagagcgacagaatgcttcttttgacgtccagaaactcatt
tgtattttggatggtgggcctgaaaagaccaaaagaaaacgagaaattgtgtcactggtc
ttaaatgatccagattttgatgaagtggacccaaatttcctgtctcgcagtgagcgttat
gatcaaactgtaagaaagagcgctcaaatgatctcgaagcttagaggcattgtagatcca
gaggagatttacatctacagtatagagttatgcaaccagtttggcactctgggaccgcag
tatgtcatggtcctcccaaccctgtacagccagtgtgatcaagaacagtccaagaagtgg
ttacctttggccagatccttcaaggttatgggtacctatgcccagactgagctgggccat
ggtactcatctgagaggccttgaaaccactgccacttatgatccagcaacacaagagttt
gtcttaaacagtcccacagttacctccatcaaatggtggcccggagctcttggaaagacg
tcaaaccatgctattgttttagctcagctttatactcatggacattgccatggtctgcat
gcttttattgtacagctccgacacatggacacgcatgaacctctcccaggtattttggtt
ggtgatattgggcctaagttcggcttttgtgaagttgacaatggatttttgaaactggat
aatgttcggattccacgagaaaacatgctcatgaaatatgcaaaggtggagccggatggt
cgctatgtgaagccccccagtgccaagctcacctatggaacaatggtgtttgttcggtcc
cttattgttggtctgtctgccataaacttggctaagtcatgtacaattgccattcgctac
agcgctgtacgtcatcagtctgaaattcgttccggagaacctgagccccagatcttggac
tatcaaacacaacagtacaaacttttccctttgctggcaacagcctatgcattcaccttt
gtgggtcagtacataagccaaacctatcatcgtatcactggagacatcaaccatggagac
ttcagtgaactgccagagctccatgccctctctgctggactgaaggcctttaccacttgg
gcaactaacagtggcattgaagtgtgccgcatgtcttgtggtggacatggttattcctgc
agcagtgcctttcctgacctttatgtacagttcactcccacctgcacatatgaaggggaa
aatactgttatgatgttgcagactgcaagatacctggtcaaaagctacaggcaagccaaa
gctggtcaacagctgaaaggcattatggcatatctgaatgacatggagcagcgtcaagtc
cgagcccatccggcctctgccaggccaaccgtcgtggacatcaatgacctgagtaacctt
gtggaaagctataaactacgggctgcaacacttgttgagtctgctgccagaagcatccag
caagagttacagaagaggaaaaatcaagaagacgcttggaataacagtgctattgactta
gtcagagcctcagatgcccattgtcactatgtggtagtgaagctcttcacagaaaagctg
agtgagatcggggacacagccatacactcggtgctgtccaccctggctctgttgtatgct
ctgcatggcatcacaaaaaactctggggacttcttgcaggctggacttctgactgtgcct
cagatgcagcagatctctgtgcgtattaaagagctgctgtgtctgctcagacccaacgct
gttgcactggtggatgcctttgatttcaatgacaaaaatctcaactctgtcctgggacga
tatgatggaaatgtttatgagaacctgtttgactgggcccggaggtcaccactcaatgct
acagaggtccatgagtcctttcacaagtacctgaagcctctgcggtccatgctctga

DBGET integrated database retrieval system