KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166371Help
Entry
110166371         CDS       T05002                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04020  Calcium signaling pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110166371
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110166371
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bpec04030]
    110166371
G protein-coupled receptors [BR:bpec04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110166371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF4199
Motif
Other DBs
NCBI-GeneID: 110166371
NCBI-ProteinID: XP_020787265
Position
Unknown
AA seq 305 aa AA seqDB search
MGYYAICCQPLVYRHKMTPVRVAVMLGGCWLIPTFISFLPIMQSWNAIGIEDIIAERRAL
AGGANDTSCVFLVNWPYALICSAVAFYVPLALMILAYQRIYVTAMSHVRQIETLQRAGSA
PVSGTTPIMTVRASTSSDPLDHYRLRPPHGAVPSEHGPMVNSRMRIETKAAKTLAVIMGC
FCLCWAPFFITNIVDPFIHYSVPWQLWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLVIL
CCGDERYTRQGSHSYGHTNRACSAASVNGTSMALRLSFLPNRSYSDNGRTILANEQESQD
SLGTL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggtattatgccatctgctgccagccgctggtctacagacacaagatgaccccggtg
cgagtggctgtgatgctcggtggctgctggctcattcccactttcatctcttttttaccc
atcatgcaaagctggaacgccatcggcatcgaggacataatcgcagagcggcgggcttta
gctggcggtgctaatgacaccagctgtgtgttcctggtgaactggccgtacgctctgatc
tgttcggctgtagccttctacgtccctctggcactcatgatcctggcctaccagcgcatc
tacgtcaccgccatgagccacgtacgccagatcgagaccttacagcgcgcaggctccgcc
cctgtttctggaacgacaccgatcatgactgtgcgagcatccacttcttcggaccccctg
gaccactacagactcaggccaccccatggtgccgtcccctcagaacacggtcccatggtg
aacagtcgcatgaggatagagactaaagcagctaagactctggctgtgatcatgggctgc
ttttgcctgtgctgggcaccatttttcatcaccaacattgtagacccgttcattcactac
tcagtgccctggcagctgtggacagcgtggttgtggctggggtatataaactcaggactt
aaccccttcctgtacgccttcctgaacagggcgtttcggagggcctttctggtcatcctg
tgctgtggggacgagcgctacacacggcagggcagccactcatatggacacaccaacaga
gcgtgctccgccgcatcggtcaacgggacgtccatggccctcagactgtccttcttaccg
aaccggagctacagtgacaatggccgaacaatactggccaatgaacaagaatcgcaggac
tctctagggacactatga

DBGET integrated database retrieval system