KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166556Help
Entry
110166556         CDS       T05002                                 

Gene name
ppig
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase G
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bpec03041]
    110166556 (ppig)
   03110 Chaperones and folding catalysts [BR:bpec03110]
    110166556 (ppig)
Enzymes [BR:bpec01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110166556 (ppig)
Spliceosome [BR:bpec03041]
 Complex C
  Other components
   PPlases
    110166556 (ppig)
Chaperones and folding catalysts [BR:bpec03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110166556 (ppig)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 110166556
NCBI-ProteinID: XP_020787469
Position
Unknown
AA seq 691 aa AA seqDB search
MGVKAQRPRCFMDIAIGNVFVGRIVVELFSDICPKTCENFRCLCTGERGIGKGTQKPLHY
KGCLFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEYLLSMANRGKDTN
GSQFFITTKPTPHLDGVHVVFGHVISGQEVVQTMENQKTDPNSKPYADVKVLNCGELVPK
SKAKKESKKKKEGSSGSSSSSSSESESSSESSSDSEDSEKESKKKKKKTKKQKKYKKKQK
KTKPEDASADEKEQEEVVSSTVRPEEIPPIPENRFLMRRSPQQVEKKDEPKKEQRNKGER
PSAGISYNSAYNRRLVMTRSGRKIKGRGPRRYRTPSRSRSRSRDRFRRSETPPHWRQEMQ
RQRMRAVTGERWIKGDRGDVNDSKEEVSKRERRLSNSKHEDTTEGKKDKKARNHRSKSKE
DDSVDKDGKHGKHKTHKKKGESRSKSREKKRSKSREKGHKSHKSDEKRARSKSKDKEDSK
KDKHSESDHGKDKSKHESSKKHKEDFKGTNGERNRSKSRSKDKKDGHRSSSSNRNKDSRA
KSRDKDDRRDKERDRGRNRSRSRDRRRDSERETKRRESSRSRDHRGRSSDRTKTRDAHRS
RHSRSKSNKRETSKDRSTHRKDKERESGNRKRRHSSSSDSDRDKRRSRNSRDRKSKEKRS
PERQRPDSNKGKDRNNSRRHRHSSSSSSDSD
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaaggcacagcgccctcggtgcttcatggacattgccattggcaatgttttt
gtcgggagaattgtggtggaattgttttcagatatttgtcccaaaacctgtgaaaacttc
aggtgtctttgcactggtgaaaggggaattggtaaaggaacccagaaacccttacactac
aaaggatgtctcttccatcgcattgttaaagattttatgattcaaggaggagactttagc
gaaggaaatggaagaggaggtgaatcgatctatggaggcttttttgaagatgaaagcttt
gctgttaaacacaacaaggaatacctgctgtcaatggccaacagaggcaaagacactaat
ggatcacagtttttcataactacaaaacccacacctcacctcgatggcgtccatgttgtt
tttggccatgtgatctctggtcaagaggttgttcaaactatggaaaaccagaaaactgac
cctaacagtaaaccctatgctgatgtgaaagtattgaactgcggagaacttgtccctaaa
tctaaagccaaaaaagaaagtaaaaagaaaaaggaaggctcatctggatccagcagcagt
agtagtagtgaatctgagagctcatctgaatcatcctctgattcagaagattctgaaaag
gagtccaagaagaaaaagaaaaagacaaagaaacaaaagaaatacaaaaagaagcaaaag
aaaacaaagccagaagacgccagtgcagatgagaaggagcaggaggaagtggtttcttct
acagtgcgtccggaggagattccccccatccctgaaaatcggttcctgatgagaagaagc
ccgcagcaagtggagaagaaggatgagcctaaaaaggagcaacggaacaagggggaaaga
cccagcgctggtatatcctataattcggcatacaacagaaggctggttatgacccgctcc
ggaagaaagataaaaggcaggggtcctaggcgttatcgaaccccttcacgctctcgttca
aggtccagagatcggttcaggcgcagtgaaactcctccacactggcgtcaggaaatgcaa
cgtcagaggatgagggctgttactggggagcgttggattaaaggggacagaggtgacgtc
aatgacagtaaggaagaggtgtcaaagagagaaagacgattgtccaattcaaaacatgaa
gataccacagagggtaaaaaggacaagaaagcgaggaatcacagatctaagagcaaagag
gatgattctgtggataaagatggaaaacatggcaaacacaagacccacaagaagaaaggc
gaaagtcgtagtaaaagccgtgagaaaaaaaggtcaaagagcagagagaagggacataaa
tctcacaaatctgacgagaaaagggcacggtccaaaagcaaagacaaagaggactcaaag
aaagataaacactcagaatctgaccatggaaaagataaaagcaaacatgaatctagtaaa
aagcataaagaggattttaaaggaacaaatggggaaagaaataggtccaaatcacgtagc
aaggacaaaaaagatggccacagatctagcagcagtaatagaaataaggacagtcgtgcc
aaatccagagacaaagacgacaggcgggataaggagagagacagaggcaggaatcgcagc
cgaagtcgagaccgtcgccgtgatagtgaaagggaaactaagaggagagagtcatccaga
agcagagatcatcgagggagaagctcagacaggactaagaccagagacgcccacaggagc
aggcactcgcgaagcaagagtaacaaaagagagaccagtaaagaccgctctacgcatagg
aaggataaagaacgagaatctggcaaccgcaaaagaagacatagcagcagttctgatagc
gatagggataaaagaaggagccgaaacagtcgtgatagaaaatccaaagaaaaaaggagt
ccagaaagacaaaggccagacagtaataaaggcaaagatcgaaataacagtagaagacat
agacatagttctagctcaagttccgacagtgactga

DBGET integrated database retrieval system