KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166693Help
Entry
110166693         CDS       T05002                                 

Gene name
acads
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00071  Fatty acid degradation
bpec00280  Valine, leucine and isoleucine degradation
bpec00410  beta-Alanine metabolism
bpec00640  Propanoate metabolism
bpec00650  Butanoate metabolism
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
bpec01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110166693 (acads)
   00650 Butanoate metabolism
    110166693 (acads)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110166693 (acads)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110166693 (acads)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110166693 (acads)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     110166693 (acads)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 110166693
NCBI-ProteinID: XP_020787640
Position
Unknown
AA seq 405 aa AA seqDB search
MAALFTARKVFSSCVNGCRRLSQLAELPETHQILKQTCRDYADRELSPIASRLDKEHLYP
VKQIHELGAMGVMAIEVPEELGGAGMDYLAYSVALEEISRGCASTGVIVSVNNSLYIGPI
LKFGTEEQKKEWITPFTTGEKVGCFALSEPGNGSDAGAASTVAHQEGEEWVLNGTKAWIT
NSWDASATVVFATTDKKLKHKGISAFLIPMPHPGLSLGKKEDKLGIKASSTANIILEDCR
IPLSNMLGPRGAGFKIAMQTLDSGRIGIASQALGIAQASLDCAADYAHKRNAFGAPIGRL
QAIQFKLADMALAIESARLLAWKASLLRDAKKPFTKEAAMAKLAASEAATFCSHQAIQIL
GGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIAGQILKEYKQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctttttacagcaagaaaagttttttcttcatgtgtgaatggttgtcgaaga
ttgtctcagttagcagagttaccagagacgcatcaaatccttaaacaaacctgcagagac
tacgctgaccgagaactgtcacccattgcttcaagactagacaaagagcatttatatcct
gtcaaacagatccatgagctgggtgcaatgggtgtaatggctattgaagtaccagaggag
ctgggtggagctggaatggactatcttgcatacagtgtggccttggaagaaatcagcaga
ggatgtgccagcactggggtcattgtctctgtcaataattcactttatataggcccaatt
ttgaaatttgggactgaggaacagaaaaaggagtggataacaccttttacaacaggagag
aaagtaggctgttttgcactcagtgaaccaggtaatggcagtgatgcaggtgctgcttcc
acagtggcacaccaagagggagaagagtgggtgcttaatggtacaaaagcttggattacc
aacagctgggatgcgtcagctactgtagtatttgccacaacggataagaaactaaaacat
aagggtatcagtgcgttcctcatcccgatgcctcacccaggactgtctcttgggaagaag
gaagataagctgggaattaaggcttcatcaactgccaacattatccttgaggactgcagg
ataccactgtcaaacatgctgggtcctcgtggcgctgggtttaaaattgccatgcaaact
cttgacagtggccggataggaatagcatcccaggctctcggtattgctcaggcatcacta
gattgtgctgcagactatgcacataaacgcaatgcatttggagcacccattggtcggctg
caggcaatacagttcaagcttgctgacatggccctagccatagaaagtgcacgtctgctc
gcatggaaagcgtcactcctcagagatgccaaaaaaccttttacaaaggaagctgctatg
gcaaagctggccgcatcggaagctgccactttctgctctcatcaggcaatccagattttg
ggtggaatgggttatgtgaccgacatgcctgcagaaagacattatcgagatgctcgtatc
acagaaatctatgaaggcaccagtgagatccaaagactggtaattgcaggacagatactg
aaagaatacaaacaatga

DBGET integrated database retrieval system