KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166990Help
Entry
110166990         CDS       T05002                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpec02000]
    110166990
   04147 Exosome [BR:bpec04147]
    110166990
   04090 CD molecules [BR:bpec04090]
    110166990
Transporters [BR:bpec02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   110166990
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110166990
CD molecules [BR:bpec04090]
 Proteins
  110166990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 110166990
NCBI-ProteinID: XP_020787950
Position
Unknown
AA seq 918 aa AA seqDB search
MDCNYNIEEGSDMSYEESDFALPSPLQMPSPVNVGPYDEERRRADEVGEDRMETVIIPFD
SEAYLNVNTNATTRGDAQAYVELNELQGSSWQETARWVGFEENLNTATGKWSGSHVSYLT
FKSLIQLRKAMSSGAFIFDSDASSLSSVAEKIVDELLNKNEIRAVDREALLRALLMRRSQ
MEAPAVTAEGNIQMQTFSVTQNRDNSDNMEASIVLSGVVENLQKPAVGFVRLKDSVVMPS
TLESPVPVRFVFVLVGPSNSGIDYSQCGRAMGALMADWVFCLEAFLAQTDKDVTDAIADF
MDCSIVLPPTEIQDQKMLEPIINFQRKMLRDRLRPIDNRLAFGDRVKADKAPEPPREDPL
ARTGYPFGGMFRDIKRRYRHYISDYVDGLNPQVLAAIIFIYFAALSPAITFGGLLADKTE
KWMGVSELMISTAVQGVIFCLLAAQPVLVIGFSGPLLLFEEAFYAFCKASNMEYIVGRIW
VGMWLIVIVVIIVAVEGSFLVRFISRFTQEIFSILISLIFIYETFAKLFKIFKTHPLILN
YDHLNDSSPNPFHPIIHTHYEYTPDGNFTIIEKEMERAYPNTALLSMCLMFGCFFIAYFL
RIFKNGPYLPGPVRRLIGDFGVPIAIFCMIAVDISIDDAYTQKLVVPKGVEVTNPKVRGW
FINPMGEKKPFPIWMMGASCVPALLVFILIFLESQITTLIVSKPERKMVKGSGFHFDLLL
LVVMGGISSIFGVPWLSAATVRSVTHANALTVMSKGPKPEIEKVVEQRISGIAVAALVGV
SIYMEPVLKMIPMTALFGIFLYMGITSLSGVQMWDRMCLLITPKKYHPADAYATRVKTWR
MHMFTFIQIICLAILWAVKMSNFSLALPFVLLLTIPLRMFMTGPLFSDFEMKCLDADDAK
VKFEEEPGEDVYYEAPLP
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggattgcaattataatattgaagagggtagtgacatgtcatatgaagagagtgatttt
gcactgccctccccactgcaaatgccttctcctgtcaacgttggcccctatgatgaagag
aggaggagggcagacgaggtaggagaggaccgcatggagactgttatcatcccgtttgat
tcagaggcttacttgaatgtgaacaccaatgccaccactcgaggagatgcacaggcctat
gttgagctgaatgagcttcaggggagcagttggcaggagacggcacggtgggtgggtttt
gaggagaatctgaacacagccacagggaaatggagtggatcccatgtgtcctacctcact
ttcaagagtctcatccagctcagaaaagctatgagttcaggtgcattcatctttgactcg
gatgccagcagtctgtcctctgtggcagagaagatagttgatgaacttctgaacaaaaac
gagatcagagctgtggaccgggaggctctgctcagggctctgctcatgagacgcagtcag
atggaggcccctgctgtgactgcggaaggaaacatccaaatgcagactttttctgtcact
cagaacagagacaattctgacaacatggaagcctccattgttctgtctggtgtggtggag
aacctgcagaagccagcggtgggctttgtgcgtctgaaggactctgtggtgatgccgtct
actctggagtctccggtcccagtccgatttgtctttgttctggttggacccagtaacagc
ggcatcgactacagccagtgcgggagagccatgggggcactgatggctgactgggttttt
tgcctcgaggcattcttggctcaaacagacaaagatgtaacagacgccatcgcagatttt
atggactgcagtatcgtgcttcctccgaccgagatccaggaccagaaaatgctcgaaccg
attatcaacttccagagaaaaatgctccgtgaccgactgcgtcccattgataaccgtctg
gcgtttggagacagagtcaaagctgacaaagccccagagcccccgcgggaagaccctctt
gcccgtacaggataccccttcggagggatgttcagggacataaagcggcgctatcgtcac
tacatcagcgactacgtggacggactcaaccctcaggtgctcgccgccatcatcttcatc
tacttcgccgctctgtccccggccatcaccttcggaggacttctagctgacaaaacggaa
aagtggatgggggtttccgagctcatgatctcgaccgctgtccaaggcgtgatcttctgt
ctcttggcagcacagcctgttctcgtcattggattctctggaccactgcttttgtttgaa
gaggccttttacgctttttgtaaagccagtaacatggagtacatcgtgggtcgcatctgg
gtgggcatgtggctcatcgtcatagtggtcatcattgtggcagttgagggtagttttctg
gtcagattcatctcccgcttcacccaggaaatcttctccatcctcatctcactcatcttc
atctacgagaccttcgctaagctctttaagattttcaaaacccaccctctgattctgaac
tacgatcacttgaatgattcgagtccaaacccatttcatccaatcatccatacgcactat
gagtacacccctgacggtaacttcaccatcatagagaaggaaatggagcgggcgtacccc
aacaccgccctcctctccatgtgccttatgttcgggtgcttcttcattgcatatttcctc
cggatcttcaagaacggcccgtaccttcctggacctgtccgtcgtttgattggagacttc
ggtgtgccaatcgccatcttctgcatgattgctgtggatatcagcattgatgatgcttac
actcagaaactggtggtgcctaaaggagtggaggtgaccaaccccaaggtaagaggctgg
tttataaaccccatgggggagaagaagcccttccctatctggatgatgggtgcctcctgt
gtccctgctctcctcgtcttcatcctcatcttcctcgagtcccagattacaactctgatt
gtgagcaaacctgagagaaagatggtgaaagggtctggtttccacttcgacctgctcctc
ctagtggtcatggggggtatctcttctatctttggggtgccatggctgagtgctgccaca
gtccgatctgttacccacgccaacgccctcaccgtcatgtccaagggccccaaacccgag
atcgaaaaagtggtggagcaaaggatcagtggcatcgctgtggccgcgctggttggtgtt
tcgatttacatggagcctgtgctgaagatgattcccatgacggctctgtttgggatcttc
ctttatatgggaatcacatctctgagcggagtccagatgtgggacaggatgtgtctgctc
attacaccaaagaaatatcaccccgctgatgcttatgccaccagggtgaagacgtggcgc
atgcacatgttcaccttcatccagatcatctgtttggccattctgtgggcggtgaagatg
agtaacttctctctggctctgccttttgttctgctgctcaccatcccactgcgcatgttc
atgactggccccctcttctctgatttcgagatgaaatgtctggatgcagatgacgccaaa
gtgaagtttgaggaagaacctggagaggatgtgtactacgaggctcctctgccataa

DBGET integrated database retrieval system