KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168432Help
Entry
110168432         CDS       T05002                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec03410  Base excision repair
bpec04210  Apoptosis
bpec04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110168432
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110168432
   04217 Necroptosis
    110168432
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bpec03032]
    110168432
   03036 Chromosome and associated proteins [BR:bpec03036]
    110168432
   03400 DNA repair and recombination proteins [BR:bpec03400]
    110168432
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110168432
DNA replication proteins [BR:bpec03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110168432
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    110168432
DNA repair and recombination proteins [BR:bpec03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     110168432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 110168432
NCBI-ProteinID: XP_020789531
Position
Unknown
AA seq 533 aa AA seqDB search
MAPKRRAAASTAAKARGKRVKQEPETPQKPKDAYTSAKEALKAAAPEKKGKRKVDEHCYL
SGEVYEDYDCMLNQTNIGHNNNKFYVIQVIKDGPSCFHTWTRWGRVGETGQNKPSTFKTV
GEAIKEFEKKFKDKTKNNWSDRDNFVSHPGKYTLIEVDGEQDAEVKVDSVDGKSKSNKNV
QPCTLNKPTQKLMELIFSTDMFKEAMEEMNLDIKKMPLGKLSKMQIAKGFDVLEEIEAAL
NRKSKQSELEELSSKFFTIIPHNFGRVRPPTINSNEIIEKKKEMLMVLADIELAQTLKSE
TEKAQEEMIETVPHPADQDYSSLKCNLTLLDKKSQTYKIIEKYLNETKCSYMKISILNVW
EVDRFTEGERFSENDHLENRRLLWHGTNIAVVAAILKSGLRIMPHSGGRVGKGIYFASEN
AKSAGYVAMSKNTGIMFLNEVALGKEYTVTTDHCTLRRAPKGFDSVVARGTVEPDPSQDV
VITLDGKQVAVPQGPAIAQPQYTGSHFSNSEYLVYKESQCRIRYLLELHMKYN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaagaggagagctgctgcctccactgctgctaaagcccggggtaagagggtc
aaacaagagccagagactccccaaaaacccaaagatgcctacacttcagccaaagaagct
ctaaaggctgctgctccagagaagaaaggcaaaagaaaggtggatgaacactgctactta
tctggagaggtttatgaagactacgactgcatgcttaaccagacaaacatcggccacaat
aacaacaagttctatgtcattcaagtcataaaagatggacccagctgctttcacacttgg
accagatggggcagagtgggagaaacaggacagaacaaaccgagcacttttaaaacagtg
ggagaggctatcaaagagttcgagaagaagtttaaagataaaaccaaaaacaactggagc
gatcgggacaattttgtgtctcatcctgggaagtacaccctgatcgaggtggacggcgag
caggatgcagaggtcaaggtggacagtgtggatgggaagtccaagagtaataaaaacgtg
cagccctgtactcttaataaaccaacacagaagctgatggagctcatcttcagtacagac
atgttcaaagaggccatggaggaaatgaacctggacataaagaagatgcctctggggaag
ctgagtaagatgcagatcgcgaagggatttgacgtgttggaggagattgaagccgccctg
aaccggaaaagtaaacagtccgaattggaggaactctcatctaaatttttcaccatcatc
ccacacaactttggacgcgtcaggcccccaaccatcaactccaacgagatcattgagaag
aagaaggagatgctcatggtgcttgcagacatcgagctggcacagacactgaagtcagag
acagaaaaggcccaggaggagatgattgagactgtgcctcacccagcggatcaggactac
tcctcactcaagtgcaacctcactctgctcgacaagaagtcacaaacatacaagataatt
gagaagtacttgaacgaaacaaaatgctcatatatgaaaatcagtatcctcaatgtttgg
gaggtcgaccgatttacagagggagagcgcttcagtgagaatgaccacctggagaacagg
cgtctgctttggcacggcacaaacatcgctgtggtggcagccattttgaagagcgggctc
aggatcatgcctcactctgggggcagagtcggaaaaggcatttactttgcatcagaaaat
gcaaagtctgctggatatgtggctatgtctaaaaacactgggatcatgttcctgaatgag
gtggctctgggtaaagaatacactgtcaccaccgatcactgcacactgaggagagctcca
aaaggctttgactctgtggtggcccgaggaacagtggagccagacccctctcaggacgtg
gtcatcactctggatggaaagcaggtggcagtacctcaaggccctgccatcgcacaacct
cagtatacgggcagccacttctctaacagtgaatatcttgtctacaaagagagccaatgc
cggatacgctacctgctcgaactgcacatgaaatataattaa

DBGET integrated database retrieval system