KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168637Help
Entry
110168637         CDS       T05002                                 

Gene name
h6pd
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein isoform X1
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00030  Pentose phosphate pathway
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
Module
bpec_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bpec_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    110168637 (h6pd)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     110168637 (h6pd)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     110168637 (h6pd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N PIF
Motif
Other DBs
NCBI-GeneID: 110168637
NCBI-ProteinID: XP_020789761
Position
Unknown
AA seq 789 aa AA seqDB search
MFLCVLLLLAPLCVTAAQDEAHKPGHVSVVVLGGTGDLARKYLWQGFFELYINQVSSGHS
FSFYGGGLSPVNKSTPVLFEILKSLNCSKDVSKERCAILKEQFLRLSKYKQLKTLEDYQD
LSKSIQKKLKQEGMVEAGRLFYLSVPAFAYAEIADRINSTCRPSKGAWLRVVLEKPFGHD
FKSAQVLATQLGASLKDEEMYRIDHYLGKQVVANILQFRMQNKKHLDPMWNKYFIERVEI
VLKETLDVKGRIAFYDQYGVIRDVLQNHLTEVMTLLTMRLPLNLSNSQEVLTNKLNIFTS
LLPLSKNQAVIGQYQAYQREVQQELNKTKEHVSLTPTFAAVLAHIDETQYEDVPILMISG
KQLDERVGYARVLFKDNVFCLQNQNSVHCKPKQIVFYFGHGNLKYPAILVSKNLFKPGVI
DNEWKEVTEHEDKNVTVLGLPISDYYVQTPKVQKEAYTELISHILAGRRNSFVSTENLLA
SWDFWTPLLTSITNTFPRIYPGGDANKDMLDILLKGRDLNYINEVVLINNDQKGGQTANT
VQIMQGKFRNDEMVSGWTEELIEKLASDIEEAAEKAILESGVFHLAVSGGASPLALFHRL
ALHHFAFPWRDTHVWMVDERCVALNEFESNFHSLHDHLLQHVKIPYYNIHPMPVQLNQRL
CVEEDKGTWLYEEEIKKFVNASRFHFVLLGVGYDGHIASLFPGVKPEHHGESFVVLTESP
VKPHQRMSLTFNAINRAQKVAILLIGKYKHEAVIQLSRVKEETTQWPVTWVKPDSGSLIW
YIDYEALLG
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgttcctatgtgtgctgctgctgttggcccctctgtgtgtgaccgctgcccaggatgag
gctcacaaacctgggcacgtgtctgtggtggtactggggggcactggagacctggcccgc
aaatacctgtggcaaggattcttcgaactctacataaaccaagtcagcagtgggcacagt
ttttccttctatggtggaggactctcacctgtcaacaagtccactcctgtgctttttgag
attttaaagagcttaaactgctctaaagatgtttcaaaagagcgctgtgccatacttaaa
gaacagttcttgcgtctgtcaaaatacaagcagcttaagactctagaagattaccaagat
ctatctaaaagcattcaaaagaagctcaaacaagaggggatggttgaagcagggagactg
ttctacctctcagtgcctgcttttgcctatgcagagattgcagacaggatcaatagtacc
tgtagaccgtcaaagggagcatggctacgagtggtcctggaaaaaccttttgggcatgat
tttaaaagtgcacaagtgttagcaacacaactgggagcctcgctaaaggatgaggaaatg
tatagaatcgaccattacttgggaaaacaggtggtggcaaacatacttcagttcaggatg
cagaacaagaagcacctcgacccaatgtggaataaatacttcatcgaaagagtggaaatc
gttttaaaagaaacacttgatgtgaaaggtcgcatagcgttctatgaccagtacggagtg
atcagagacgttctgcagaaccatctcacggaggtcatgaccctgctaacaatgagacta
ccactgaacctgagcaacagccaggaggtgctcacgaacaaacttaatattttcacatct
ctgctgcccctgagtaagaaccaggcggtgatcggacagtaccaggcctaccagagagag
gtccaacaagagctcaacaaaaccaaggaacacgtcagtctgactcccacgtttgcagct
gtcctggcccatatcgacgagacccaatacgaagatgtcccaattctcatgatctcagga
aaacagttggacgagcgagtgggttatgcccgggtgctttttaaggacaacgtcttctgt
ctccaaaatcaaaacagcgtccactgcaaacccaaacagatagtcttctactttggacat
ggcaacctgaagtaccccgcaatccttgtgagcaaaaatctgttcaaaccaggtgttatt
gacaacgaatggaaagaagtaactgaacatgaagataaaaatgttacagttttagggttg
cctatttcagactattatgtacaaacaccaaaagtccaaaaggaagcctacacagagttg
atttctcatatattagctggacgaagaaatagttttgtcagtacagaaaatcttctagcc
tcttgggatttttggaccccgcttttaactagcatcaccaacacattcccacgaatttat
ccaggaggtgatgcaaacaaggacatgcttgacatcctactcaaaggaagagacttgaac
tatatcaatgaagtggttctaattaacaatgatcaaaaaggtggacaaactgctaatact
gtccaaatcatgcagggcaaatttcggaatgatgaaatggtctcagggtggacggaagag
ctaatagaaaagctagcatcagacatagaagaagcagcagagaaggctattcttgaaagt
ggagtttttcatttagcggtatcaggcggggcgtctccattggcgctatttcacagactg
gctttgcaccattttgcgtttccgtggagagatacgcacgtttggatggtggatgaacgc
tgtgtagctttaaatgaatttgaatcaaattttcatagcctccatgaccacctactccaa
catgtaaagataccatattataatatacacccaatgcccgttcagctaaaccaacgcctc
tgcgtggaagaagacaaaggaacttggttatatgaagaggagatcaagaaattcgttaat
gcctctagatttcattttgttttattaggtgttggttatgatggtcacatagcctctcta
tttccaggagttaaaccagagcatcatggggaaagtttcgttgttttaacagaaagccca
gtaaaacctcaccagagaatgagtctaacttttaatgcaataaaccgagcacagaaagtg
gcaattttattaataggaaaatataaacacgaggcagtaatacagctgagcagagtgaaa
gaggagacaacgcagtggcccgtgacttgggtgaagccagacagtggcagtctgatctgg
tacatagactatgaggcattgttagggtaa

DBGET integrated database retrieval system