KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168775Help
Entry
110168775         CDS       T05002                                 

Gene name
wnk2
Definition
(RefSeq) serine/threonine-protein kinase WNK2
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110168775 (wnk2)
   01009 Protein phosphatases and associated proteins [BR:bpec01009]
    110168775 (wnk2)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110168775 (wnk2)
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: Other
  Wnk family
   110168775 (wnk2)
Protein phosphatases and associated proteins [BR:bpec01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110168775 (wnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110168775
NCBI-ProteinID: XP_020789921
Position
Unknown
AA seq 2048 aa AA seqDB search
MNSAEDSSLKPPRGSTFSSEPNLDTGSTGNTRRLVYVNGTDHNVNIQNEAVRGASDSSTD
YRGLVRQRFIRRTMWMSDSEEQPLDPQDFPNTSSVPTIDLRAIVGRSRTRNQETSNTESH
VALKDNDTESASADEDKGESRVPEPKSDSAALDVTGKAGSDENEEEPGMKAVSTSPGGRF
LKFDIELGRGSFKTVYKGLDTDTWVEVAWCELQERKLSKVERQRFKEEAEMLKALQHPNI
VRFYDFWETQLKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLHFLHT
RTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYD
EAVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASYSKVSDPEIKEIIGECI
CHKWEERYSIKDLLNHAFFAEDTGVRVELNEEDDGEKMTIALKLWVEDAKKLKGKYKDTG
AIEFTFDLVNEVPEVVAQEMVDSGFFLDCDVKIVSKSIRDRVALIKWRRERRVTVTNGEA
VKKPQSNRLQVPGAVPPLAPDCEEQETEPQTLVCSVPTIAPATSDTGVSSTIQSDEHQTQ
QNVPFQSLPESSTQISSPPSQADPRLLQGSHQQTAAQASKETYSAPPIQQQSKHLLEGKD
LTLLDHCLHHIVGRRTSSPTLQATWSPCQQTVPISLFDDSSQDMDLPLPLPSNLCRNPVF
PLENEDRPGSLTVSAPEAPPTAQNLSSSSVPTPPQTQLSCQLEQVSGDVPSSYPSPPDMS
ANLPHSVPVLPLQINTQFSSPYPGTNTGVQPSLLSNLSSTHPSSGSVLPSSPTAHLTLPL
NTPLHPSTLTPLSSHTALHVPSVTLSSPLLAPTMLAAVSPQQNCPGSHTSPCDIHPPHFL
PFSQVQPTPYPAKYHEQLLTGQPVQVHVITPLNNLGDHLPAPAPSVIPPAQSALVGSEDK
ETAAAAQKIGPGAVPDSVSAETPLPLHSQGLCSPPKLPPPAAVCQTAGPHTSVVSVQMKH
QSSPPADPVIPLTSAPSIPGASPVAAAALAQAQTAATPQMAALQSAGILSTVSLPECASL
PPTQQNTEATSASSTLQQDHYLEIQDLLKEKPTSLPNYCFDSVNSDAASGKEYSDGYDSF
ASVGKGDGKHKKHRKSARTRSRQEKTSKPKLSMLNVSNTGDKMVECQLETHNHKMVTFKF
DLDGDAPEEIATYMVENGFILLIEKEIFIDQLKDIVDKAEDMLHENMEGEKVAVLSCSPK
HGQTSDSQLGETGAFQPVYQQNVLHTGKRWFIICPVEETPRQETTSTTVQSPGTSAPAQD
DFGVRQPSNLREDGSSSTMSGGSGGFPYDVYGFCSPPIMSNTDPLLLATLSPPVSAPPTL
QSVPPVESAASSVSQAPLPLEESQASPVGSMSPINTVQPLTELSHPAALAEELPCCPLVL
SLDVSGPQTGTPLTPLPLHEPTLSKEPLSLAYTSAARDRPQQPVVLHQPFSNVTKVSSLP
QSPASSQHGAGAAESDAEGRVGRGGFVDSTIKTLDEKLRNLLYQEYAPMYPSGSAAETPG
SGTEYIQSPPGPDSATLGSGNSTPGPIGEGRYRAGEQLPQIPERIDSLSTLSDSAVCASL
SRRQVPHSASCSGTRGRFKIISVPPEVANRRDVKQRSWSSVASPPQALGYMVEQVEVLAP
STTIGRFSVVSTEDEFTQRTRCSRYSAPPDFYLDTPSQPASSSVPVDVTVHARFMSSDSG
AESSPAKLPPCTPSQHNRSERRGSDLMKRAVAFLRRSGRSSSVQSSDSPARHGGVHGSAY
GSSDNDSEVEDSDIKRELQRLREKHLREISELQAHQRDEVELLYRRLGKAPPSGLALSHT
APPAGRRKRSGKHRLKAGKLLSPLVQQFRNVTTRTNESSKASAAVSAAAGETVVSLNGSP
AKGPFPSQGRPRSCTSHLPTSTTEPVHTQQPCSLKGSFSSDNIYSGRHGDSSTAAPPAQG
SGAGPGAFSQPHPPPSGTTPPPHQPVIGLAQANNSNNKTRSYSVTEHVLCEDLQRLMDDW
AQEWAAAL
NT seq 6147 nt NT seq  +upstreamnt  +downstreamnt
atgaattcggcggaggattcaagcctaaaaccgccacgggggtccacgttctcatctgag
cctaatttagacacgggcagcactggaaatacacgcaggctcgtgtacgtgaacgggacg
gatcacaatgtcaacatacaaaacgaagccgtgcgtggagcgagtgactcctccacagac
taccgggggctggtccggcagaggttcatccgcaggacaatgtggatgtccgattctgag
gagcagcccttggacccccaggactttcccaacaccagctctgtgcccactatagacctg
cgcgccatcgtgggccggagtcgaacccgcaaccaggagacttcaaacacagagagccac
gtagcactgaaggacaatgacacagagagtgccagcgcagatgaggacaagggggaaagt
cgcgtgccggagcccaaaagtgacagcgcggctttggatgtgacagggaaggccggaagt
gacgagaatgaagaggaacccgggatgaaagcagtgtccacttcacctgggggacggttc
ctcaagtttgacatagagctgggaaggggctccttcaagacggtctataaaggtctggac
accgacacatgggtggaggtggcctggtgtgagctgcaggaacggaaactgtccaaagtc
gagcggcagaggttcaaagaagaagctgagatgttgaaggccctgcaacatccaaatata
gtgcgcttctatgacttctgggaaacacagctgaaaggaaagaagtgcattgtactagtg
acagagctgatgacatcagggacactcaaaacgtatctaaagcgcttcaaggtcatgaag
cccaaagttctacggagctggtgcaggcagatcctgaaggggcttcacttcctccacact
aggactccccccatcatccacagagaccttaaatgtgacaacatcttcatcactggccca
accgggtcggtcaagatcggagatttgggtcttgccacactcaagagggcttcatttgct
aaaagtgtcattggcactcctgagttcatggccccggagatgtacgaggaacactatgac
gaggctgtcgatgtttatgcttttgggatgtgcatgttagaaatggccacttctgaatac
ccctactccgaatgtcagaatgctgcccagatctaccgcaaagtcaccagtggggtaaaa
ccagccagctacagcaaagtgagcgacccagagataaaggagatcataggggagtgtatc
tgtcataaatgggaagaaaggtactcaattaaagaccttttaaaccatgctttcttcgct
gaggacacaggcgtgagggtggagctcaatgaggaggatgatggggagaagatgactatt
gctctgaagctatgggtggaagatgccaaaaagctgaaggggaagtacaaggacactgga
gccattgagtttacctttgatctggtgaacgaggtccctgaagtggttgctcaagaaatg
gtcgactctggattctttctggactgtgacgtgaagattgtgagcaagtccattcgtgac
cgagtggctctgatcaaatggaggagagagcgcagagtcactgtgacaaatggagaagca
gtgaagaagcctcagtcaaaccggctgcaggtccctggagctgttccccctctggcccca
gactgtgaggagcaggaaacagagccacagacactggtctgcagtgtgcccaccattgca
cctgctacatccgacactggagtgagctccaccatccaatcagatgagcaccagacccaa
caaaatgtaccctttcagtctctgccagagtcctccactcagatttccagccctccttca
caggctgacccccgactgctgcaggggtcccaccagcaaacagcagcacaggcctcaaag
gagacctactctgcacctcccatacagcaacagtcaaagcatttgcttgaaggtaaagat
cttactttactggatcactgtctccatcacattgtggggcgcaggaccagttctcccact
ctccaagctacttggtcgccatgccaacaaacagttcctatttcactgtttgatgacagc
agtcaggacatggatcttcctttgccattgccctcaaatctgtgcaggaatcctgtgttt
ccacttgaaaatgaagacagaccaggttcattgacagtttctgctccagaggcacctcca
acagcccaaaacctttcttcttcatcagttcccactcctccacagacccagctctcttgt
caacttgaacaggtatctggtgatgtgccctcctcttacccaagtcccccagatatgtct
gctaacctcccacattcagtgcctgtgctgccactgcagatcaacacacagttttcttca
ccatacccaggcacaaacactggggttcagccctctttgctctctaatctgtcatccacc
catccaagcagtggatctgtcctgcccagttcccccacagcccatctcactctccctcta
aacacacccctccatccctccaccctcacccctctgtcatcccacactgcactgcatgtc
ccttctgtcacactgtctagtccactgcttgcccccaccatgctggctgctgtgtccccg
cagcagaactgccctggatcccacacaagcccatgtgacatccatccccctcacttcttg
cctttctcccaggttcaacccaccccttaccctgctaagtaccatgagcaactcctgact
gggcagcctgtccaggtacacgtgatcactcctttgaataatctgggagatcatctccca
gctccggccccctctgtcattccacctgctcagtctgctctcgtgggaagtgaggataaa
gaaaccgctgcagctgctcagaaaataggtccaggcgcagttcctgactcagtctcagca
gaaaccccactaccattacattctcaaggtttatgctccccaccaaagttgcctccccct
gctgcggtgtgtcaaactgcaggcccccatacttcagttgtctctgtccaaatgaagcat
cagagcagcccccctgcagacccagtgatacctctgacctcagcaccatccatcccaggg
gcgtccccggttgctgctgctgcgttggcacaagcacaaactgcagccactcctcagatg
gcagctctgcagtctgctggcatccttagcactgtgtccctgcccgagtgtgccagcctg
cccccaactcagcaaaacacagaggctacatctgcatctagcaccttacaacaagatcac
tatttagagatacaggatctgctaaaggagaaaccaacatcattaccaaactactgcttt
gacagtgtcaattctgatgcagcatctggtaaagaatacagcgatggctatgatagtttt
gccagtgtgggaaagggagatggaaagcataaaaaacaccgcaaatctgcacgaacacgg
tcacgccaagagaagaccagcaaacctaaattgagcatgctcaatgtttcaaacacaggt
gataaaatggttgaatgccagcttgaaactcacaaccacaaaatggtgacttttaaattt
gacctggatggagatgctcctgaagaaatagccacttacatggtagaaaatggtttcatc
ttactgatagagaaggagatctttattgaccagctgaaggacatagtggataaagctgaa
gatatgctacatgaaaacatggagggggagaaagtggccgtactaagctgtagtcccaag
catggccagacctcagacagtcagcttggagagactggtgcttttcaacccgtctatcaa
caaaatgtcctccacacgggaaaacgatggttcataatctgccctgtagaggagaccccc
cgtcaggagaccacgtccaccacagtgcagtcgcctgggacctctgctccagcccaggac
gacttcggagtgagacaaccttcaaacctcagagaggatggctcatcttccacaatgtct
ggtggaagtggaggatttccatatgatgtctatggcttctgtagtcctccaataatgtcc
aacacagaccccctgctcttagccactctgtcccctcctgtgtctgcccctcccactcta
cagtcagtccctccagtagagtcagctgctagctccgtctcacaggcaccgcttcctctg
gaggagtcccaggcctctcctgtgggctccatgtcccccattaacactgtccagccctta
acagagctctcccatcctgctgctttagcagaggagctgccttgctgtcctctggtcttg
tctctggatgtgagtggccctcagacagggacccctctcacccctctgcctctgcatgag
ccaactctatccaaagagcctctgtctttggcttacacatctgcagcacgtgaccggcca
caacagcctgtggtgctgcaccagcctttctccaatgtgacaaaagtgtcctctctgccc
cagagtccagcatcctcccaacatggggcaggagctgcagaatctgacgcagagggcaga
gtggggcgtgggggctttgtagatagcaccataaaaaccttggatgagaagttgaggaac
ttactttatcaggaatacgctcctatgtatccatcgggcagcgctgcagagaccccagga
tcagggactgagtacatccagtcgcctccaggtccggacagcgccaccttagggtcggga
aacagcactccagggcccattggggagggccgctatcgggcaggcgaacagcttccacag
atccctgagagaatagatagtctgagcacactcagtgattctgcagtgtgtgcttcactg
tcgagaagacaagtccctcattctgcttcttgctctgggacaagaggccggttcaagatc
atctctgtcccgcctgaagtggccaatagacgagatgtgaagcagaggagctggagcagt
gtggcctctcctcctcaggctctggggtacatggtggagcaggtggaggtcttggctccc
tccacgactattggccgtttctctgtagtgagcacagaggatgagttcacacagaggaca
cgctgcagtcgctactctgcaccaccggacttctacctggacacgccgtcccaaccggcc
tccagctctgtaccagtggatgtcactgttcatgcccgttttatgtcctctgactccggg
gcagagagcagccctgcaaagctgcccccctgcaccccatcccagcacaatcgctctgag
cggagaggaagtgacctcatgaagagggcagtggccttcctgcgtcgctcgggtcggagt
agtagtgtacagagctcggactctccagcacgtcatggaggggtgcatggttctgcttat
ggcagcagtgacaatgactctgaggtggaggattctgacatcaagagagagttgcaacgg
ctcagggaaaaacatttgcgggagatttcagaattgcaggcccaccagagagacgaagtg
gaactgctttatcgacgccttggtaaagccccaccctctggcttagcactctcccacaca
gctccacctgcaggccgcagaaagagatcaggcaaacacaggctcaaggcaggcaaactc
ttgagccctttggttcaacagttcagaaatgtcacaaccaggaccaatgaatccagcaag
gcctcagctgcagtttctgctgcagcaggtgagactgtggtgagtttgaatggatctccg
gccaaagggcccttcccgagtcagggccgcccgcgctcctgcaccagtcatctgcccaca
tctaccacagaaccagtgcacacacaacagccctgctccctcaaaggctccttctcctct
gacaacatttactctggtcgtcacggagacagtagcaccgccgctcccccggcacaagga
tctggtgcaggacctggggctttcagtcagcctcacccacccccctctggcaccacccct
ccgcctcaccagcccgtcataggtctggctcaggccaacaacagcaataacaagacgcgc
tcatacagtgtgacagagcacgtcctgtgtgaggacctgcagaggctcatggatgactgg
gcccaggagtgggcagcggctctgtga

DBGET integrated database retrieval system