KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169133Help
Entry
110169133         CDS       T05002                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00564  Glycerophospholipid metabolism
bpec00565  Ether lipid metabolism
bpec00590  Arachidonic acid metabolism
bpec00591  Linoleic acid metabolism
bpec00592  alpha-Linolenic acid metabolism
bpec01100  Metabolic pathways
bpec04010  MAPK signaling pathway
bpec04217  Necroptosis
bpec04270  Vascular smooth muscle contraction
bpec04370  VEGF signaling pathway
bpec04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110169133
   00565 Ether lipid metabolism
    110169133
   00590 Arachidonic acid metabolism
    110169133
   00591 Linoleic acid metabolism
    110169133
   00592 alpha-Linolenic acid metabolism
    110169133
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110169133
   04370 VEGF signaling pathway
    110169133
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110169133
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110169133
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110169133
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110169133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2 ArgJ
Motif
Other DBs
NCBI-GeneID: 110169133
NCBI-ProteinID: XP_020790305
Position
Unknown
AA seq 582 aa AA seqDB search
MTLNVTVLRAKTETNQDFWSQSDLYVTLTLPTAMATIRRTKTINRNDQPVWNEGFSFRVP
TKTKNVLEIRLFDEDLLSKDDLISTVLLDLETLELDSKICRSFSLNPEAAPLSVLNVKVQ
KLLHTHLLSSSPMLTLCGAYEKVQPLDPDTDKLVFHMNRELETQLALTVSIYSNICLSMK
ATEETDVEKTEVVLSAVHLKPLPPRHSGNVSLTVDQETVDLHLELNDRGEDGVGVRLSED
VSAQEKNFLYKRKTRVSQALQALLHLQSVSPHDKVPTVAVVVSGGGARACTGLLGSLKAL
KDMGVLDAVSYITVLSGSTWSMSALCQDENWSQNLESLMPKIREQMTKSMMSAFTPEKLH
YYHTEMEKKEKQGHLVSYIDMEGLIAEHYVFGQKNSSTLSDQKKTVKNGQNPLPIYTAVN
VKEAIHGNQPDTEWVEFTPFEVGMQKYGAFIKAENFGSEFFLGHLIKKLPELRLPFLMGI
WSSAFSVNITSLWKALTGRAPEWTPEDTEVDDIGVRRETEEELAAGQVDVSSSGSPYTTQ
NMTYSEEDYDALIRLTHYNATHSRDAVLSALAKALSRLTPDP
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaacgtcaccgtgctccgagccaagaccgagaccaaccaggacttctggtct
cagtcggacctgtacgtgactctgacgttgccgacggcgatggccacgattcgaagaacc
aaaaccatcaaccgcaacgaccaacctgtgtggaacgaaggcttcagcttcagagtcccc
acaaagaccaagaacgttctggagatccgtctgtttgatgaggaccttctctcgaaagac
gacctgatctccaccgtcctcctcgacctggagactctggagctcgactcgaagatctgc
aggtccttcagcctgaacccagaggcggctcctctgtctgtgctcaacgtcaaagtgcag
aagctcctccacactcaccttctgtcctcgtctccgatgttgactctgtgtggagcctat
gagaaggttcagcctctggatccggacacagacaaactcgtgttccacatgaaccgagag
ctggagacgcagctcgcgctcaccgtgagcatctactccaacatctgtttgtctatgaag
gcgacagaagaaactgatgtggagaaaacagaggtggttttatcagctgttcatctgaag
cccctcccccctcgccactcaggaaacgtctccctcaccgtggaccaggaaactgtggat
ctgcacctggagctgaacgacaggggtgaggacggggtgggggtgcgtctctcagaggac
gtctccgctcaggagaagaacttcctgtacaagaggaagaccagagtgtctcaggctctt
caggctctgctccacctccagagtgtttctccacacgacaaggtgccgaccgtggccgtg
gtggtgtcagggggcggggccagagcctgcactgggctcctgggttctctgaaggctctg
aaggacatgggagtcctggacgccgtctcttacatcaccgtcctgtctgggtccacctgg
tcgatgtcggctttgtgtcaggacgagaactggtcccaaaacctggagagcctcatgcca
aagatcagggagcagatgaccaagagcatgatgagcgccttcactccggagaagctgcac
tactaccacactgagatggagaagaaggagaaacagggtcacctagtgtcctacatcgac
atggaaggactcatcgcagagcactatgtgtttggacagaaaaactccagtactctctct
gatcagaagaagacggtgaagaacggtcagaatcctcttcccatttacacagcggtcaac
gtgaaggaggccatccatgggaaccaacctgacactgagtgggtggagttcacgccgttc
gaggtggggatgcagaagtacggagccttcatcaaagctgaaaacttcggctccgagttt
ttcctcggacatttgatcaagaagctcccggagctcagacttccatttctcatgggaatc
tggagcagcgccttctccgtcaacatcacgtctctgtggaaagctctgactgggagggcc
cccgagtggacgcccgaggacacagaagtggacgacatcggtgtgcggcgtgagacggag
gaggagctggcggcgggtcaggtggacgtgagctcctcaggttccccgtacacgacccag
aacatgacctactccgaggaagactacgacgccctgatccggctcacgcactacaacgcc
acgcacagcagagacgccgttctgtccgccctcgccaaagccctgagccgcctgacccct
gacccctga

DBGET integrated database retrieval system