KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169681Help
Entry
110169681         CDS       T05002                                 

Gene name
parp16
Definition
(RefSeq) mono [ADP-ribose] polymerase PARP16
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110169681 (parp16)
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110169681 (parp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N Exotox-A_cataly
Motif
Other DBs
NCBI-GeneID: 110169681
NCBI-ProteinID: XP_020790919
Position
Unknown
AA seq 328 aa AA seqDB search
MQPPVPVDVVRELVCSCLHRDPVAADLRCSLFVAAAQNYKRDSLLRPFPPRYISGDNKEF
EELLADVKSLPGVRELVRLRPGQGDHHLALTHWILSSKSFAIKTLEKEEYAHLCNLTKNE
GFSGPAPDFLFEIEYNDQLNARFEKTRAGRDTFYAFHGSRLENFHSIIHNGLHCHLNKNS
VFGEGTYLTSDLSMAVLYSPHSNAWRESLLGALLSCVALCEVIDHPDVKCQVKKKDSEII
DRQRSRAKNSEGGDVPQKYFVVTNNQLLRVKYLLVYSQKRHLSRNSRSSSWLLRHHFAIM
MSLYLLLLLLIGAFNSSSFVSFWKKLFR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctgtcccagttgacgtggttcgagagctggtgtgttcctgtttgcacagg
gacccagtggccgcagacctccgctgcagtctgtttgtggcagcagctcaaaactataag
agggactctctgcttagaccctttccccctcgatacatcagtggtgacaacaaggagttt
gaggaactgttggctgatgtaaagtcactacctggtgtgagggaactggtgaggctgcga
cctgggcaaggtgatcatcatttagctcttacacactggatcctctcttcaaagagtttt
gctataaaaacactggagaaagaggagtatgcccatttgtgcaacttgacaaaaaatgaa
gggttctcgggaccagcaccagacttcctgtttgagattgaatacaacgatcagctaaat
gcccgatttgagaagactagggcaggacgagacactttctatgcattccacgggagccgc
ctggaaaactttcactcaatcattcataacgggctacactgtcacctcaacaagaactct
gtgtttggagagggcacctacctgaccagtgacctcagcatggcagtcttgtatagtcca
cacagcaacgcatggagggaaagtctgctgggtgcattgctcagctgtgttgccttgtgt
gaagtcatcgaccaccctgacgtcaagtgtcaagtcaagaaaaaggactcagaaatcatt
gaccgccagagatccagagcaaagaacagtgagggtggagacgtgccacagaaatacttt
gttgtcaccaacaatcagcttttacgggtcaagtatctgctggtttactcccagaagagg
catctgtctagaaactcccggagctcttcatggctgctcagacaccactttgccatcatg
atgagtctgtaccttctgctgctgcttctgattggtgccttcaactccagctccttcgtt
tctttttggaaaaaacttttcaggtga

DBGET integrated database retrieval system