KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169902
Entry
110169902         CDS       T05002                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpec01002]
    110169902 (adamts13)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     110169902 (adamts13)
Peptidases and inhibitors [BR:bpec01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   110169902 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin TSP1_CCN Reprolysin_3 Reprolysin_4 Reprolysin_5 Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 110169902
NCBI-ProteinID: XP_020791164
Position
Unknown
AA seq 1388 aa
MFFVLLVCLLLLRPGSTAIMTSPLYKSVQWDIAKNSSVSPSWGSAQIRQYRSVNMPDVTH
LELLVVVGPDVHNVHQQDTERYILTNLNIASELLRDITLGANMRMHLVRLIILTEPEPEI
EMSPNITSSLRSVCDWGKRIHPPNDTNPLHADLLLYITRYDLVLPDGNKQVRGVTQLGGV
CSEDWSCVITEDTGFDLGITIAHEIGHSFGINHDGVENSCSSSGFMMASDGGHNSVDLTW
SSCSRQQLLTFFSKGKADCVKDLPVLGGSLHDWRPGLFYGVNEQCRIAFGKTARACTFKS
PDLPPCRVLSCHIDNDSSCKRLFVPLLDGTECGLNQWCLKGRCVSPDELDSSVVVHGSWS
GWSDFSPCSRTCGGGVTHRTRKCDNPKPAFGGHHCVGQEIQAELCHQNPCEHTQLDFMAE
QCSLTDHHPLYLYQNIASFYTWTPAIGVAKGNDQCRHMCQSERENFIVSRGSQFVDGTRC
EFDSPPPFGSTAACLKGNCQLFGCDGVLLSEKIKDNCGVCGGDGSSCTLTSDSFTGGLAK
KYITFLAIPMNATQVHIVNSAPLFTHMAVLVGGQYIVSGKGNMALNLTHPSPLDENHVEY
RLHLTPDLLPEMEELLLPGPVQQEIHIQVYRKYGKEYGEKTNPNITYKFYLQTHNRSSLT
SQPKGKWSQFITPCSVSCGSGVQKHLYLCVDQDTREQLKPKYCNRSMPSDPLYTTCQQPQ
CPPRWEIGEFGPCSSLCGGGERLRPVRCVQEHGNELMSLPVIECRNDTAPPAVEKCNMHH
CPTRWHVSELGKCSAVCGPGEAKRDVFCVWEEGGRDIKVNDSLCIQLNRPHDIVPCVVNV
CPVGWESKAEQDQPRLKFGLMPRSRPASVYVWSPVSSQCSKTCGNGTLQVWFSCLDHQTR
LGVPDFHCDASTRPQPYSEICSTSSCPPIWRSKQGVCSVTCGGGVANLVQYCAVEKERGE
VVADDTECQDFPKPKAVVACNTHSCPARWKVLQTLACSVSCGLGVAQRTVLCVQFFNGNE
SVVPDNTCHAAVKPASTVPCLMRVCSFRWEIKPWTQCSVTCGYGIQSRAVSCVGPTNPEP
VSPLLCMHMPKPLTIQGCNVGCLDKPPAPVVNPTTISTALTLSIPANHTEGPLPPPTVNL
KESPHHRIDHIRTTEAIYPLIIPTAQAPTSSICGSLLLDESGKIDLTNATSRCMVSIGRP
LDEIIHIEVESSSLDCSKREYVAFFDRMSFVRRCKQIAGSALTTRTNVLLVRQNLLTEGN
GVILKYKSQKNMKKNHHKVCDIQLFAPIGIFENPTTLDSNQTCRVLINAPPSVKIRIQAK
YIGLVFSSTNSQSSYIMIRDMDVLKTHVFSGQRLFVWQSSGNMAEVEFHGDYLRSRGIFR
AEYSFISS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgttttttgtgctcctggtctgtctgctgctgctgaggcctggctccactgctataatg
acatctccattgtacaaatcagtccagtgggatattgcaaagaattccagcgtttctcca
tcttggggctctgcgcaaatacgacagtatcgctcagtaaatatgcctgatgtgacccat
ttggaactattggttgtggttggaccagatgttcacaatgtccaccagcaggacactgaa
agatacatccttaccaatctcaatattgcttccgagttgttgagagacatcactttggga
gccaacatgaggatgcacctagtcagactgattattttgacagagccagagccagagatc
gaaatgtccccaaacatcacctcttcgcttagaagtgtttgtgactgggggaaaagaata
caccctcctaatgatacaaaccctctccacgctgatctcctgctgtacatcacgaggtat
gacctggtgttacctgatgggaataagcaggtcagaggggtgacacagctgggcggagtg
tgctctgaagactggagctgtgtaattacggaggacactggttttgacctgggaatcaca
attgctcatgaaattggtcacagttttgggatcaatcatgatggtgtggaaaacagttgc
agcagcagtggattcatgatggcctcagatggaggccataacagtgtggatttgacctgg
tcctcttgcagcagacagcagctgctcacattcttcagtaagggaaaggctgactgtgtg
aaagacctgcctgttctgggaggctctctgcatgactggaggcccggtttgttctatgga
gtcaatgagcaatgcagaatagcctttggtaaaactgccagagcctgcactttcaaaagt
ccagatttacctccgtgtcgagttttgtcatgtcatattgataatgatagctcctgcaag
cgtttgttcgtcccattgttggatggaaccgaatgtggtcttaatcagtggtgtttgaag
ggccgctgtgtgtcacctgatgagctggactcttctgtggtggtgcacggatcctggtcc
ggttggtcggatttctccccctgctcacggacatgtggtggaggagtcactcatcgcaca
agaaaatgcgataacccgaaacctgcatttggaggacatcattgtgtaggccaggaaata
caagctgaactttgtcatcaaaatccatgtgagcacacacagctggattttatggcagag
cagtgttcccttacagaccaccatccactttatctgtaccaaaatattgcatctttctat
acctggacccctgctattggcgttgcaaaaggaaatgatcagtgcagacatatgtgccag
tcagagagagaaaacttcatagtcagccgaggctctcagtttgtagatggcactcgctgt
gaattcgacagcccacctccctttggctccacggcagcttgtctaaaagggaactgccag
ctctttggctgtgatggcgtcctgctctctgagaaaattaaggacaactgtggagtgtgt
ggcggagatggatcatcctgtactttaacctctgactccttcactgggggcctggcaaaa
aagtacattacctttttggcaattcctatgaatgccacacaagttcatattgtaaacagt
gcgccactcttcacacatatggctgtgttagttggaggtcagtacatagtatctggtaag
ggaaacatggctctgaatttgacacatccttctccattggatgaaaatcatgtagaatat
cgtcttcacttaacccctgaccttttaccggagatggaagagcttcttctacctggacca
gtgcaacaagagatacatatacaagtttatcgcaaatatggtaaagaatatggggaaaaa
acaaacccaaacattacttacaaattttatctacaaactcataacagatcgtcattaacc
agccaacctaaaggcaaatggtctcagtttataacaccatgctcagtctcttgtggatca
ggtgtccagaaacatttatacttatgtgtggatcaagacaccagagaacagttaaagccc
aagtactgtaataggtctatgccctctgatccactttacacaacctgccagcaacctcaa
tgtcctcccaggtgggaaataggggagtttgggccttgtagttcactgtgtggtggagga
gagaggctccgccctgttagatgtgtccaagaacatggaaatgaacttatgtctctacca
gttattgaatgtaggaatgacacagcgccacctgctgttgaaaaatgtaacatgcaccat
tgccctaccagatggcatgtctcagagctaggaaaatgctcagcagtgtgcgggcctgga
gaggctaaacgtgatgtgttctgtgtctgggaagaaggtggacgagatatcaaagtgaat
gacagcctctgcatacagctgaatcgcccccatgatatagttccctgtgtagtaaatgtg
tgcccagtgggatgggaatctaaggctgagcaggaccagccaaggttaaagtttggtctc
atgccacggtcaaggccagcttctgtgtatgtgtggagtcctgtgagcagccagtgctca
aagacctgtggcaatgggaccctgcaggtgtggttttcctgtctggaccaccaaacccga
ctgggtgtgcctgacttccactgtgatgcctcaaccagacctcagccttattcagagatc
tgtagcacatcatcatgccctcccatatggcgctctaagcaaggagtctgcagtgtaaca
tgtggaggaggggtagccaacctagtgcaatactgtgctgtggaaaaagagagaggagag
gtagttgcggatgatacagagtgccaagactttccaaaaccaaaagcagtggtggcctgc
aatacccacagctgcccagctaggtggaaggttttgcagacactagcctgctctgtgtct
tgtggattgggtgtagctcaaagaacagttttgtgtgtccagttttttaatggaaatgaa
agtgtagtgccagacaatacttgccatgctgctgtcaaaccagcctccacggtgccctgt
ctaatgcgagtctgttcattcaggtgggaaatcaagccatggacccagtgttctgtaacc
tgtggctatgggatccagtccagagccgtgtcgtgtgtagggcccacaaatcctgaacca
gtcagccctctgctttgtatgcacatgcccaagcctctaactattcagggctgcaacgtg
ggctgcctagacaagccacccgcgcctgttgtcaatcctactaccataagcactgcatta
actctttcaataccagctaaccacacagaaggaccactcccccctcccactgtgaacctc
aaagaatcaccacatcatcgcatagatcatatacgtacaacagaggcaatttatcctttg
ataattccaactgcacaagcacccacatctagtatatgtgggagtttactgttggatgaa
tccgggaaaatagacttaaccaatgcaaccagccgttgtatggtctcaataggtagaccc
ttggatgaaatcattcacattgaagtggaatcaagctccctagactgcagtaaaagggag
tatgtggccttttttgatcgcatgtcatttgtgaggaggtgcaaacagatagccggtagt
gcactgactacaagaactaatgtcctcttggtgcgccagaatttactaactgagggaaat
ggagtgattctcaaatacaagtcacagaaaaatatgaaaaaaaatcaccacaaagtttgt
gacatacagctctttgctcctattggaatatttgagaatcccaccaccttggacagcaat
cagacatgccgagttctaatcaatgctcctccctcagtaaaaatcaggattcaagcaaaa
tacataggattagtattcagttctaccaactctcagtcttcatatataatgatcagggac
atggatgtcctaaagacccatgtgttcagcgggcagagattgtttgtgtggcaatcttct
ggaaacatggcggaagtggaatttcatggggactatctgcgttccagagggatctttaga
gctgaatattctttcataagctcatag

DBGET integrated database retrieval system