KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110171143Help
Entry
110171143         CDS       T05002                                 

Definition
(RefSeq) anti-Muellerian hormone type-2 receptor-like
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04060  Cytokine-cytokine receptor interaction
bpec04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110171143
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110171143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110171143
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110171143
Protein kinases [BR:bpec01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110171143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110171143
NCBI-ProteinID: XP_020792489
Position
Unknown
AA seq 342 aa AA seqDB search
MALFWRHRWLLVECVILSITHLALSQKRRCIFQVPHNLDFHEYGYVNGSVQYCDFTDCCV
GYYIIKNGELEVESLEERANSLHDPLCAKPADIDIQLQRIVCEGVFATVWEGRYQGTRVA
VKVFPMAWKHKFIAEREVYQLPLMAQEGIVQFLGSGPIGTYEVLVLQYAKYGSLHSYLST
HTSSWKSSLVLCQSLSQGLSYLHSDLHKDGVHKPAVAHRDLSSSNVLVKADGTCALSDFG
CSTILCSGPNSCHFYSRKLEVKSYTHLYRMGTLRYMSPEILQGSVCLNSNWCLQGDIYSL
GLVLWEIWMRCSDLFGSERIPLHLLPYENELGTSVPLHEITM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctcttttctggcgacatcggtggctacttgtggaatgtgtcatcctaagcatcacc
catttggctttatctcagaagaggcggtgtattttccaagttccacacaaccttgatttt
catgagtatggttatgtgaatggatcagtgcagtattgtgattttactgattgctgtgta
ggttattacataatcaaaaatggtgaacttgaagttgaatctcttgaagaacgtgcaaac
tctcttcatgatccactgtgtgccaaacccgcagacattgacatacaactacagcggatt
gtgtgtgaaggggtttttgctactgtttgggaagggagataccagggcacccgtgtggct
gtgaaggtttttcctatggcctggaaacacaagtttattgcagaacgtgaagtttaccag
cttccattgatggcacaggaagggattgtccagttcttgggctctggacctattggcaca
tatgaagtccttgttcttcaatatgctaaatatggttctctgcattcttatttatcaaca
cacacctccagctggaagtcatcactcgtgttgtgtcagtccttatcacagggactttct
tacctccactcagaccttcacaaagatggtgttcataagcctgcagtggcccatagagac
ctcagcagctctaatgtccttgtgaaagcagatggaacctgtgcccttagtgattttggg
tgctctactattctgtgctctgggccaaacagctgtcatttttactccagaaaactagaa
gtgaagtcatacacgcatttataccggatgggtacgctgcgttacatgtcacctgagatc
ctgcagggctctgtgtgccttaacagtaactggtgtcttcagggagacatctactctttg
ggactagtcctgtgggaaatctggatgcgatgctctgatttatttggtagtgagaggatt
ccactgcatctacttccatatgaaaacgagttggggaccagtgtaccacttcatgagatc
acaatgtga

DBGET integrated database retrieval system